Lus10033420 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G19210 181 / 6e-58 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G74930 144 / 2e-43 AP2_ERF ORA47, ERF018 Integrase-type DNA-binding superfamily protein (.1)
AT5G21960 138 / 1e-40 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT4G31060 107 / 3e-29 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT3G50260 97 / 1e-25 AP2_ERF DEAR1, CEJ1, ATERF#011 DREB AND EAR MOTIF PROTEIN 1, cooperatively regulated by ethylene and jasmonate 1 (.1)
AT1G21910 98 / 4e-25 AP2_ERF DREB26 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1)
AT4G36900 97 / 4e-25 AP2_ERF DEAR4, RAP2.10 DREB AND EAR MOTIF PROTEIN 4, related to AP2 10 (.1)
AT5G67190 97 / 4e-25 AP2_ERF DEAR2 DREB and EAR motif protein 2 (.1)
AT2G23340 97 / 5e-25 AP2_ERF DEAR3 DREB and EAR motif protein 3 (.1)
AT4G06746 94 / 3e-24 AP2_ERF DEAR5, RAP2.9 DREB AND EAR MOTIF PROTEIN 5, related to AP2 9 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034885 379 / 1e-135 AT1G19210 172 / 2e-54 Integrase-type DNA-binding superfamily protein (.1)
Lus10038082 140 / 1e-41 AT5G21960 155 / 3e-47 Integrase-type DNA-binding superfamily protein (.1)
Lus10009798 130 / 3e-38 AT1G19210 132 / 1e-39 Integrase-type DNA-binding superfamily protein (.1)
Lus10010043 100 / 1e-26 AT2G23340 170 / 1e-54 DREB and EAR motif protein 3 (.1)
Lus10009373 98 / 1e-25 AT5G67190 164 / 3e-52 DREB and EAR motif protein 2 (.1)
Lus10018727 96 / 8e-25 AT5G67190 162 / 1e-51 DREB and EAR motif protein 2 (.1)
Lus10009468 85 / 6e-21 AT1G22810 132 / 1e-40 Integrase-type DNA-binding superfamily protein (.1)
Lus10002801 87 / 1e-20 AT5G11590 209 / 4e-68 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Lus10007799 83 / 2e-20 AT2G44940 136 / 7e-42 Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G138800 194 / 1e-62 AT1G19210 189 / 3e-61 Integrase-type DNA-binding superfamily protein (.1)
Potri.018G047300 171 / 4e-54 AT1G19210 169 / 1e-53 Integrase-type DNA-binding superfamily protein (.1)
Potri.006G218200 170 / 2e-53 AT1G19210 176 / 4e-56 Integrase-type DNA-binding superfamily protein (.1)
Potri.006G138700 168 / 9e-53 AT1G19210 174 / 1e-55 Integrase-type DNA-binding superfamily protein (.1)
Potri.018G038100 112 / 2e-31 AT5G21960 100 / 5e-27 Integrase-type DNA-binding superfamily protein (.1)
Potri.006G138900 108 / 4e-30 AT5G21960 86 / 3e-21 Integrase-type DNA-binding superfamily protein (.1)
Potri.006G080300 98 / 1e-25 AT4G31060 143 / 1e-43 Integrase-type DNA-binding superfamily protein (.1)
Potri.007G046500 96 / 8e-25 AT5G67190 149 / 7e-46 DREB and EAR motif protein 2 (.1)
Potri.005G140900 96 / 2e-24 AT5G67190 169 / 1e-53 DREB and EAR motif protein 2 (.1)
Potri.014G025200 94 / 2e-24 AT1G46768 160 / 3e-51 related to AP2 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Lus10033420 pacid=23172148 polypeptide=Lus10033420 locus=Lus10033420.g ID=Lus10033420.BGIv1.0 annot-version=v1.0
ATGGTGAAACAATCACCAACTAGAGTAGAGAGACATACAGCAGCAGCAGCAGCAGCCGCCGCCGCCGACGAATTGAAGTTTAAGGGAGTAAGGAAGAGGA
AATGGGGCAAGTGGGTGTCGGAAATCAGGCTACCAAACAGCCGAGACCGCATTTGGTTGGGTTCCTACGACTCCCCAGAGAAAGCTGCTAGAGCATTCGA
CGCCGCCCTTTTCTGCTTACGTGGACCCACCGCCAAGTTCAATTTCCCTGACAATCCCCCCACACACATCCCCGGTGCCGGCTCGCTTTCTCGCGACCAG
ATTCAGGAAGCCGCCGTTCGGTTCGCCAATTCAGAACCGAATCTTTCGGGTTGGTCTAACTCTGGGTCGGCTGAGTCCCCCTGCCCATCTTCCGACATCG
AACCAGTTCAGTCCCCTCCACCTGCTGAGCTGCCTCTCGACGACTCATTCTTGGAACAGCTTGCCAACATGGGGTCGGGTCCTGCTACGTTCGCATCCGA
CTACGGGATATTCCCCGGTTTTGATGATTTGTGCAATGATTACTTCGAACAAACTACTGGAATGTTCAACTATGGGGAAGAGCAAACTACTCAGGACCAA
GTTTTTGGTGGTCAGGATTCATTTCTCTGGAATTTCTAA
AA sequence
>Lus10033420 pacid=23172148 polypeptide=Lus10033420 locus=Lus10033420.g ID=Lus10033420.BGIv1.0 annot-version=v1.0
MVKQSPTRVERHTAAAAAAAAADELKFKGVRKRKWGKWVSEIRLPNSRDRIWLGSYDSPEKAARAFDAALFCLRGPTAKFNFPDNPPTHIPGAGSLSRDQ
IQEAAVRFANSEPNLSGWSNSGSAESPCPSSDIEPVQSPPPAELPLDDSFLEQLANMGSGPATFASDYGIFPGFDDLCNDYFEQTTGMFNYGEEQTTQDQ
VFGGQDSFLWNF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G19210 AP2_ERF Integrase-type DNA-binding sup... Lus10033420 0 1
AT1G19210 AP2_ERF Integrase-type DNA-binding sup... Lus10034885 1.0 0.9726
AT5G47390 MYB myb-like transcription factor ... Lus10004384 2.0 0.9555
AT4G00300 fringe-related protein (.1.2) Lus10018823 2.4 0.9596
AT5G44210 AP2_ERF AtERF9, ATERF-9 ERF DOMAIN PROTEIN- 9, erf dom... Lus10015415 3.5 0.9245
AT1G19210 AP2_ERF Integrase-type DNA-binding sup... Lus10009798 3.5 0.9321
AT4G29780 unknown protein Lus10011946 3.9 0.9593
AT5G42570 B-cell receptor-associated 31-... Lus10030043 5.7 0.9209
AT5G21960 AP2_ERF Integrase-type DNA-binding sup... Lus10038082 7.1 0.9248
AT3G06260 GolS9, GATL4 galactinol synthase 9, galactu... Lus10012765 7.6 0.8472
AT4G11070 WRKY ATWRKY41, WRKY4... WRKY family transcription fact... Lus10023099 8.1 0.9387

Lus10033420 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.