Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23220 92 / 9e-25 AP2_ERF ESE1 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1) AT3G23230 88 / 5e-23 AP2_ERF ERF98 Integrase-type DNA-binding superfamily protein (.1) AT5G43410 84 / 8e-22 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G04370 83 / 3e-21 AP2_ERF ATERF14 Ethylene-responsive element binding factor 14 (.1) AT5G51190 81 / 9e-20 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT3G23240 81 / 2e-19 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1) AT1G06160 80 / 3e-19 AP2_ERF ORA59 octadecanoid-responsive Arabidopsis AP2/ERF 59 (.1) AT5G47220 79 / 8e-19 AP2_ERF ATERF-2, ERF2, ATERF2 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1) AT2G31230 79 / 1e-18 AP2_ERF ATERF15 ethylene-responsive element binding factor 15 (.1) AT5G47230 79 / 2e-18 AP2_ERF ATERF5, ATERF-5, ERF5 ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR- 5, ethylene responsive element binding factor 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021873 [exp] 89 / 5e-23 AT3G23230 143 / 4e-44 Integrase-type DNA-binding superfamily protein (.1) Lus10025430 [exp] 86 / 4e-22 AT3G23240 132 / 6e-39 ethylene response factor 1 (.1) Lus10021196 [exp] 84 / 9e-22 AT3G23230 131 / 3e-40 Integrase-type DNA-binding superfamily protein (.1) Lus10011831 [exp] 83 / 3e-21 AT3G23230 132 / 2e-40 Integrase-type DNA-binding superfamily protein (.1) Lus10011830 [exp] 83 / 5e-21 AT3G23230 134 / 4e-41 Integrase-type DNA-binding superfamily protein (.1) Lus10022936 [exp] 81 / 1e-20 AT3G23230 114 / 9e-34 Integrase-type DNA-binding superfamily protein (.1) Lus10024883 [exp] 81 / 3e-20 AT3G23230 130 / 3e-39 Integrase-type DNA-binding superfamily protein (.1) Lus10032499 [exp] 83 / 4e-20 AT5G51190 186 / 8e-59 Integrase-type DNA-binding superfamily protein (.1) Lus10013959 [exp] 80 / 4e-20 AT3G23240 124 / 2e-36 ethylene response factor 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G039300 [exp] 96 / 6e-26 AT3G23220 82 / 2e-20 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1) Potri.010G072400 [exp] 91 / 3e-24 AT3G23230 85 / 1e-21 Integrase-type DNA-binding superfamily protein (.1) Potri.010G072600 [exp] 89 / 1e-23 AT3G23220 91 / 4e-24 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1) Potri.008G166000 [exp] 87 / 6e-23 AT3G23230 94 / 3e-25 Integrase-type DNA-binding superfamily protein (.1) Potri.008G166100 [exp] 84 / 1e-21 AT3G23230 82 / 2e-20 Integrase-type DNA-binding superfamily protein (.1) Potri.011G061700 [exp] 84 / 7e-21 AT3G23240 111 / 1e-30 ethylene response factor 1 (.1) Potri.013G045200 [exp] 84 / 9e-21 AT3G23240 167 / 5e-52 ethylene response factor 1 (.1) Potri.004G051700 [exp] 83 / 1e-20 AT5G47220 111 / 1e-30 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1) Potri.005G223100 [exp] 81 / 2e-20 AT3G23230 101 / 2e-28 Integrase-type DNA-binding superfamily protein (.1) Potri.002G039200 [exp] 81 / 4e-20 AT3G23230 113 / 7e-33 Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10033884 pacid=23172742 polypeptide=Lus10033884 locus=Lus10033884.g ID=Lus10033884.BGIv1.0 annot-version=v1.0 ATGGACGCAGCAGCAGCAGGAGGAGGAGGGATAGGAACATATAGCGTCGATCAAATCCGATACAGAGGAGTAAGGAAGCGGCCGTGGGGGAAATTCGCGG CGGAGATTCGAGACACCACCAATTACGGCGCAAGACTCTGGCTTGGAACTTTCAGTACGGCGGAGGAAGCAGCCAGAGCTTACGACAGAGCTGCTTTTTC CATGAGGGGTTCTATGGCCATCCTCAATTTCCCTCAGGAATACCCCCCTTCTTCTTCTTCTTCTTCTTCTTCCTCTTCTTCGTCCATATTGTCAGTGGTG GGAACCCGGCCGATGACGGCGATGGCAGAGGAGGAGGAAGGAAAAGGAGTGATCGTGATCGAGTGTTTGGATGACAAGTTGCTTGAAGACCTTCTTAATT TCTAG
AA sequence Show only first row Show all	>Lus10033884 pacid=23172742 polypeptide=Lus10033884 locus=Lus10033884.g ID=Lus10033884.BGIv1.0 annot-version=v1.0 MDAAAAGGGGIGTYSVDQIRYRGVRKRPWGKFAAEIRDTTNYGARLWLGTFSTAEEAARAYDRAAFSMRGSMAILNFPQEYPPSSSSSSSSSSSSILSVV GTRPMTAMAEEEEGKGVIVIECLDDKLLEDLLNF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G23230	AP2_ERF	ERF98	Integrase-type DNA-binding sup...		Lus10033884 [exp]	0	1
AT3G51030		ATTRX1, ATTRXH1	ARABIDOPSIS THALIANA THIOREDOX...		Lus10028349 [exp]	7.3	0.8858
					Lus10003556 [exp]	12.8	0.8733
AT2G16600		ROC3	rotamase CYP 3 (.1.2)		Lus10013552 [exp]	17.9	0.8699
AT4G17720			RNA-binding (RRM/RBD/RNP motif...		Lus10011063 [exp]	19.7	0.8604
AT1G55790			Domain of unknown function (DU...		Lus10039534 [exp]	19.9	0.8596
AT1G28520	VOZ	ATVOZ1, VOZ1	vascular plant one zinc finger...		Lus10005274 [exp]	22.0	0.7996
					Lus10032860 [exp]	24.2	0.8613
AT4G32870			Polyketide cyclase/dehydrase a...		Lus10006042 [exp]	27.7	0.8578
					Lus10010378 [exp]	29.9	0.8594
AT5G24860		ATFPF1, FPF1	ARABIDOPSIS FLOWERING PROMOTIN...		Lus10000506 [exp]	31.7	0.8190

Compare expression of checked genes

Lus10033884 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.