Lus10035073 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G46620 266 / 3e-86 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT3G28580 103 / 1e-24 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G17760 99 / 3e-23 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT5G40010 98 / 8e-23 ASD, AATP1 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
AT3G28510 97 / 1e-22 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT4G25835 96 / 2e-22 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT3G50940 96 / 3e-22 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT4G30250 96 / 4e-22 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G40000 95 / 7e-22 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT3G50930 95 / 7e-22 BCS1 cytochrome BC1 synthesis (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005991 390 / 1e-134 AT2G46620 598 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10030220 292 / 4e-96 AT2G46620 603 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10008834 202 / 3e-61 AT2G46620 473 / 2e-163 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10022362 117 / 1e-30 AT2G46620 362 / 8e-123 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10024275 101 / 4e-24 AT3G50940 434 / 2e-149 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10007391 101 / 5e-24 AT3G50940 424 / 2e-145 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10014496 101 / 6e-24 AT5G40010 577 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
Lus10032188 100 / 8e-24 AT5G40010 497 / 4e-173 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
Lus10006295 92 / 3e-23 AT2G46620 132 / 2e-37 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G102300 306 / 4e-102 AT2G46620 598 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.002G175600 295 / 1e-97 AT2G46620 627 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.012G020800 147 / 9e-41 AT2G46620 536 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.015G007800 145 / 6e-40 AT2G46620 503 / 1e-175 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.007G020500 101 / 2e-24 AT2G18193 511 / 1e-179 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.007G020600 102 / 3e-24 AT2G18193 553 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.019G020700 101 / 4e-24 AT5G40010 531 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
Potri.019G020800 101 / 5e-24 AT5G40010 526 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
Potri.013G047950 100 / 1e-23 AT5G40010 538 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
Potri.009G024400 99 / 4e-23 AT4G25835 362 / 4e-120 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00004 AAA ATPase family associated with various cellular activities (AAA)
Representative CDS sequence
>Lus10035073 pacid=23162382 polypeptide=Lus10035073 locus=Lus10035073.g ID=Lus10035073.BGIv1.0 annot-version=v1.0
ATGACCGGTCTGATTTACCTAACAAAGAAGTGGTGGAGAGTCGTGGAGGATCGGCTCCATGTCTACCAGTACTTTAAGGTTCCTGAATTCAACGCCAATG
AGAACGAGCAATACCGGAGAGTCACTCTGTACCTGAATTCTCTGGAATCCATGGAGGATTCTGATTTCACCAATCTGTTTACAGGAAGAACCTCCAGCGA
TATCCTCCTCCGCCTCGATCCTAATCAGGTGATTGATGACTATTTTCTCGGAGCGAGAGTTTCCTGGATTAACGGCGATGACGGCGGCGGAGGTGGTAGG
ACTTTGGTTTCGAAGGTTAAAAGAGCTGACAAGCGGCGAATTCTCCGGCCTTATCTTCAGCATATCCACACCGTCTCAGACGAGCTTGACGAGAGGAAGA
AGGAAGCTCTACATGAACGCAATCGAGAGACTCGGCGGAGGCGGCGGCAATCTGAAAAGCAAGCTGAAGTCAGATCTGGAGTCGTTCCACAGAGCCCGAC
AGTAGTACCACCGTCTCGGCCGCGTTTGGAAGCGGAGCTACTTGTTGTAGAACCGCCAGGCACTGGAAAATCCAGCTTCGTCGCTGCCATGGCGAATTTC
TTGAGATACGACGTCTACGAGATCGATCTCTCCAGAGTCAGGGACGATTCGGATCTAAAGGCGATCCTGCTTCAAACGATGAGCAGGTCAGTGATCGTGA
TCGAGGATCTCGATCGGTTTCTGACGGAGAAATCAAAAGATTCAAAACCATCCGCCGTGACCCTGGCCGGTATGCTGAATTTCATGGACGGAGTTCTCAG
CTCCTGCGCCGCGGAGGAGAGGATAATTTGGTTAAGGGGATTACGATAA
AA sequence
>Lus10035073 pacid=23162382 polypeptide=Lus10035073 locus=Lus10035073.g ID=Lus10035073.BGIv1.0 annot-version=v1.0
MTGLIYLTKKWWRVVEDRLHVYQYFKVPEFNANENEQYRRVTLYLNSLESMEDSDFTNLFTGRTSSDILLRLDPNQVIDDYFLGARVSWINGDDGGGGGR
TLVSKVKRADKRRILRPYLQHIHTVSDELDERKKEALHERNRETRRRRRQSEKQAEVRSGVVPQSPTVVPPSRPRLEAELLVVEPPGTGKSSFVAAMANF
LRYDVYEIDLSRVRDDSDLKAILLQTMSRSVIVIEDLDRFLTEKSKDSKPSAVTLAGMLNFMDGVLSSCAAEERIIWLRGLR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G46620 P-loop containing nucleoside t... Lus10035073 0 1
AT4G03030 Galactose oxidase/kelch repeat... Lus10000704 1.4 0.8660
AT5G54310 NEV, AGD5 NEVERSHED, ARF-GAP domain 5 (.... Lus10038582 2.4 0.8471
AT4G32250 Protein kinase superfamily pro... Lus10002923 4.9 0.8527
AT4G30790 unknown protein Lus10007700 8.1 0.8002
AT3G23280 XBAT35 XB3 ortholog 5 in Arabidopsis ... Lus10009674 10.6 0.7906
AT5G42940 RING/U-box superfamily protein... Lus10018725 14.4 0.8200
AT5G42940 RING/U-box superfamily protein... Lus10024810 20.8 0.7569
AT5G67190 AP2_ERF DEAR2 DREB and EAR motif protein 2 (... Lus10018727 22.2 0.7655
AT3G23280 XBAT35 XB3 ortholog 5 in Arabidopsis ... Lus10009035 23.4 0.7340
AT5G05610 Alfin AL1 alfin-like 1 (.1.2) Lus10027805 23.9 0.7096

Lus10035073 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.