Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G03870 177 / 9e-60 EMB2816 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) AT2G23930 57 / 4e-12 SNRNP-G probable small nuclear ribonucleoprotein G (.1.2) AT3G11500 55 / 2e-11 Small nuclear ribonucleoprotein family protein (.1) AT1G65700 46 / 1e-07 Small nuclear ribonucleoprotein family protein (.1.2.3) AT1G76860 45 / 3e-07 Small nuclear ribonucleoprotein family protein (.1) AT1G21190 42 / 3e-06 Small nuclear ribonucleoprotein family protein (.1) AT3G14080 42 / 4e-06 Small nuclear ribonucleoprotein family protein (.1.2) AT5G44500 40 / 4e-05 Small nuclear ribonucleoprotein family protein (.1.2) AT4G20440 40 / 6e-05 SMB small nuclear ribonucleoprotein associated protein B (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017019 [exp] 56 / 1e-11 AT3G11500 150 / 2e-49 Small nuclear ribonucleoprotein family protein (.1) Lus10021342 [exp] 55 / 2e-11 AT3G11500 152 / 3e-50 Small nuclear ribonucleoprotein family protein (.1) Lus10042884 [exp] 45 / 2e-07 AT1G65700 158 / 7e-52 Small nuclear ribonucleoprotein family protein (.1.2.3) Lus10028183 [exp] 43 / 2e-06 AT1G65700 155 / 8e-51 Small nuclear ribonucleoprotein family protein (.1.2.3) Lus10026326 [exp] 41 / 7e-06 AT1G76860 176 / 4e-59 Small nuclear ribonucleoprotein family protein (.1) Lus10040487 [exp] 41 / 8e-06 AT1G76860 175 / 8e-59 Small nuclear ribonucleoprotein family protein (.1) Lus10011293 [exp] 41 / 8e-06 AT1G76860 175 / 8e-59 Small nuclear ribonucleoprotein family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G269500 [exp] 189 / 2e-64 AT2G03870 183 / 8e-62 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Potri.009G064000 [exp] 189 / 2e-64 AT2G03870 183 / 8e-62 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Potri.006G211100 [exp] 56 / 7e-12 AT3G11500 153 / 2e-50 Small nuclear ribonucleoprotein family protein (.1) Potri.016G078100 [exp] 55 / 3e-11 AT3G11500 152 / 5e-50 Small nuclear ribonucleoprotein family protein (.1) Potri.001G278000 [exp] 46 / 1e-07 AT1G65700 146 / 3e-47 Small nuclear ribonucleoprotein family protein (.1.2.3) Potri.005G191600 [exp] 44 / 5e-07 AT1G76860 176 / 3e-59 Small nuclear ribonucleoprotein family protein (.1) Potri.002G068800 [exp] 43 / 1e-06 AT1G76860 175 / 1e-58 Small nuclear ribonucleoprotein family protein (.1) Potri.001G440100 [exp] 39 / 0.0001 AT4G20440 211 / 2e-67 small nuclear ribonucleoprotein associated protein B (.1.2.3.4) Potri.011G155700 [exp] 39 / 0.0001 AT4G20440 218 / 2e-70 small nuclear ribonucleoprotein associated protein B (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [flax] [poplar] Sm-like PF01423 [flax] [poplar] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Lus10035639 pacid=23147334 polypeptide=Lus10035639 locus=Lus10035639.g ID=Lus10035639.BGIv1.0 annot-version=v1.0 ATGTCTGGAAGAAAAGAAACGGTCTTGGATTTGGCGAAGTTTGTGGACAAGGGCGTCTCAGTCAAGCTCACCGGTGGTAGACAAGTTACGGGAACATTGA AAGGATATGATCAGCTGTTAAACCTTGTGCTGGATGAAGCAGTGGAGTTTCTACGAGATTCTGACGATCCACTGAAGACTACAGACCAAACGAGGACACT TGGACTAATTGTCTGCAGAGGGACTGCTGTAATGTTGGTATCACCAACTGATGGTACAGATGAGATTGCCAACCCCTTTGTCCAGCCAGATGGTACCTAG
AA sequence Show only first row Show all	>Lus10035639 pacid=23147334 polypeptide=Lus10035639 locus=Lus10035639.g ID=Lus10035639.BGIv1.0 annot-version=v1.0 MSGRKETVLDLAKFVDKGVSVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDSDDPLKTTDQTRTLGLIVCRGTAVMLVSPTDGTDEIANPFVQPDGT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G03870		EMB2816	EMBRYO DEFECTIVE 2816, Small n...		Lus10035639 [exp]	0	1
AT1G16000			unknown protein		Lus10023116 [exp]	1.4	0.8361
AT4G18100			Ribosomal protein L32e (.1)		Lus10031699 [exp]	2.0	0.8552
AT2G20450			Ribosomal protein L14 (.1)		Lus10024918 [exp]	7.1	0.8354
AT4G31460			Ribosomal L28 family (.1)		Lus10003683 [exp]	7.1	0.7629
AT1G55205			unknown protein		Lus10024700 [exp]	9.9	0.8036
AT3G24570			Peroxisomal membrane 22 kDa (M...		Lus10034922 [exp]	10.8	0.7882
AT1G18850			unknown protein		Lus10023616 [exp]	10.9	0.7745
AT2G19740			Ribosomal protein L31e family ...		Lus10042028 [exp]	13.0	0.8117
AT3G18165		MOS4	modifier of snc1,4 (.1)		Lus10018001 [exp]	13.8	0.7895
AT1G56590		ZIP4	ZIG SUPPRESSOR 4, Clathrin ada...		Lus10031432 [exp]	15.9	0.7884

Compare expression of checked genes

Lus10035639 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.