Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G25190 141 / 8e-43 AP2_ERF ESE3 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) AT1G15360 84 / 2e-20 AP2_ERF WIN1, SHN1 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) AT5G25390 80 / 6e-19 AP2_ERF SHN3, SHN2 shine3, Integrase-type DNA-binding superfamily protein (.1.2) AT5G11190 79 / 2e-18 AP2_ERF SHN2, SHN3 shine2, Integrase-type DNA-binding superfamily protein (.1) AT1G22190 71 / 8e-15 AP2_ERF RAP2.4 related to AP2 4, Integrase-type DNA-binding superfamily protein (.1) AT1G36060 69 / 5e-14 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G78080 68 / 8e-14 AP2_ERF CAF1, RAP2.4, WIND1 wound induced dedifferentiation 1, related to AP2 4 (.1) AT4G13620 68 / 1e-13 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G39780 67 / 2e-13 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT2G22200 67 / 2e-13 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016815 [exp] 257 / 9e-89 AT5G25190 206 / 1e-68 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10041023 [exp] 137 / 6e-41 AT5G25190 205 / 7e-68 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10005343 [exp] 108 / 2e-30 AT5G25190 174 / 3e-56 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10005716 [exp] 85 / 2e-20 AT1G15360 236 / 3e-79 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10030097 [exp] 84 / 4e-20 AT1G15360 234 / 1e-78 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10009480 [exp] 82 / 5e-20 AT1G15360 207 / 1e-68 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10019414 [exp] 82 / 2e-19 AT1G15360 207 / 1e-67 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10041614 [exp] 81 / 4e-19 AT5G25190 165 / 1e-51 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10002015 [exp] 76 / 4e-17 AT1G15360 183 / 4e-59 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G261200 [exp] 155 / 4e-48 AT5G25190 169 / 9e-54 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.018G021900 [exp] 151 / 1e-46 AT5G25190 169 / 1e-53 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.001G048200 [exp] 131 / 4e-39 AT5G25190 162 / 5e-51 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.018G131400 [exp] 84 / 3e-20 AT1G15360 194 / 6e-63 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.006G069400 [exp] 82 / 2e-19 AT1G15360 186 / 9e-60 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.018G028000 [exp] 81 / 2e-19 AT5G11190 204 / 8e-68 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.003G033000 [exp] 81 / 2e-19 AT1G15360 181 / 3e-58 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.006G253800 [exp] 81 / 4e-19 AT5G11190 197 / 1e-64 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.003G179900 [exp] 70 / 4e-15 AT5G25190 100 / 1e-26 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.007G090600 [exp] 68 / 1e-13 AT1G78080 205 / 4e-63 wound induced dedifferentiation 1, related to AP2 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10035859 pacid=23147513 polypeptide=Lus10035859 locus=Lus10035859.g ID=Lus10035859.BGIv1.0 annot-version=v1.0 ATGGCGAGACCACAACAACGATACAGAGGCGTTCGACAGCGGCACTGGGGCTCCTGGGTTTCCGAAATTCGACACCCATTATTGAAGACTAGAATCTGGC TAGGCACATTCGAGACGGCTGAGGATGCAGCTCGAGCTTACGACGAAGCCGCTAGGCTGATGTGCGGGCCAAGAGCAAGGACCAATTTCGTCCCAAATCA TGTGACGAGTACTCATTCCGCTTCCTCAAAGCTCCTACTCTCTGCCAATCTCACTGCCAAATTGCATAGGTGCTACATGGCTTCCTTGCAAATCACCACA AATTCACAAACCAATGACATGATGAGTTCAGTGAAAAGGGAGGAAACGGGCAGAGTCCAATTGGGAGCAGAGTCCAATAATTGGGAGAGTATGAAGAAAG TTGATGAAGTGGTTGACGACATCAACAAGCAGCAGCCATTGGAGGATCATGACATTGAACAAATGATACAAGAGCTGCTTCATTATGGCTCCATTGAGCT CTCTTCTTCCACCGTTTCACCTAACTCCCTGTAA
AA sequence Show only first row Show all	>Lus10035859 pacid=23147513 polypeptide=Lus10035859 locus=Lus10035859.g ID=Lus10035859.BGIv1.0 annot-version=v1.0 MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAARAYDEAARLMCGPRARTNFVPNHVTSTHSASSKLLLSANLTAKLHRCYMASLQITT NSQTNDMMSSVKREETGRVQLGAESNNWESMKKVDEVVDDINKQQPLEDHDIEQMIQELLHYGSIELSSSTVSPNSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G25190	AP2_ERF	ESE3	ethylene and salt inducible 3,...		Lus10035859 [exp]	0	1
AT5G09760			Plant invertase/pectin methyle...		Lus10013721 [exp]	2.0	0.8300
AT5G57770			Plant protein of unknown funct...		Lus10019972 [exp]	2.4	0.8049
AT3G17130			Plant invertase/pectin methyle...		Lus10016319 [exp]	2.6	0.8574
AT3G23710		AtTic22-III	translocon at the inner envelo...		Lus10022378 [exp]	3.9	0.8089
AT5G55830			Concanavalin A-like lectin pro...		Lus10022521 [exp]	4.9	0.7569
AT1G28600			GDSL-like Lipase/Acylhydrolase...		Lus10015477 [exp]	4.9	0.7924
AT3G17130			Plant invertase/pectin methyle...		Lus10002739 [exp]	7.7	0.8273
AT3G61490			Pectin lyase-like superfamily ...		Lus10007922 [exp]	10.8	0.7857
AT5G21105			Plant L-ascorbate oxidase (.1....		Lus10025538 [exp]	11.0	0.7890
AT5G09760			Plant invertase/pectin methyle...		Lus10005587 [exp]	13.5	0.7829

Compare expression of checked genes

Lus10035859 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.