Lus10036257 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G25060 109 / 1e-30 AtENODL14 early nodulin-like protein 14 (.1)
AT5G25090 103 / 3e-28 AtENODL13 early nodulin-like protein 13 (.1)
AT4G31840 102 / 6e-28 AtENODL15 early nodulin-like protein 15 (.1)
AT3G20570 102 / 1e-27 AtENODL9 early nodulin-like protein 9 (.1)
AT5G57920 99 / 2e-26 AtENODL10 early nodulin-like protein 10 (.1)
AT4G30590 92 / 7e-24 AtENODL12 early nodulin-like protein 12 (.1)
AT2G23990 86 / 3e-21 AtENODL11 early nodulin-like protein 11 (.1.2)
AT4G27520 83 / 3e-19 AtENODL2 early nodulin-like protein 2 (.1)
AT4G28365 81 / 3e-19 AtENODL3 early nodulin-like protein 3 (.1)
AT4G32490 81 / 4e-19 AtENODL4 early nodulin-like protein 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022160 177 / 5e-58 AT2G25060 76 / 5e-18 early nodulin-like protein 14 (.1)
Lus10019955 139 / 3e-42 AT4G30590 120 / 1e-34 early nodulin-like protein 12 (.1)
Lus10026880 112 / 2e-31 AT5G25090 167 / 8e-53 early nodulin-like protein 13 (.1)
Lus10003432 111 / 4e-31 AT5G25090 167 / 5e-53 early nodulin-like protein 13 (.1)
Lus10011158 89 / 3e-22 AT3G20570 149 / 2e-45 early nodulin-like protein 9 (.1)
Lus10043063 88 / 6e-22 AT3G20570 153 / 4e-47 early nodulin-like protein 9 (.1)
Lus10018617 83 / 5e-20 AT4G28365 150 / 5e-46 early nodulin-like protein 3 (.1)
Lus10039852 83 / 5e-20 AT4G28365 150 / 8e-46 early nodulin-like protein 3 (.1)
Lus10032111 77 / 3e-18 AT5G14345 147 / 1e-45 early nodulin-like protein 21 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G264600 125 / 4e-37 AT2G25060 184 / 9e-60 early nodulin-like protein 14 (.1)
Potri.018G018200 120 / 7e-35 AT2G25060 177 / 7e-57 early nodulin-like protein 14 (.1)
Potri.006G184100 115 / 7e-33 AT4G31840 174 / 5e-56 early nodulin-like protein 15 (.1)
Potri.017G011200 83 / 6e-20 AT4G32490 157 / 2e-48 early nodulin-like protein 4 (.1)
Potri.011G135400 81 / 4e-19 AT3G20570 138 / 4e-41 early nodulin-like protein 9 (.1)
Potri.011G117800 81 / 1e-18 AT5G53870 158 / 3e-45 early nodulin-like protein 1 (.1)
Potri.001G398800 78 / 2e-17 AT4G28365 145 / 9e-42 early nodulin-like protein 3 (.1)
Potri.001G419200 75 / 8e-17 AT3G20570 153 / 1e-46 early nodulin-like protein 9 (.1)
Potri.001G187700 71 / 1e-15 AT1G79800 176 / 2e-56 early nodulin-like protein 7 (.1)
Potri.003G050500 71 / 2e-15 AT1G79800 162 / 1e-50 early nodulin-like protein 7 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10036257 pacid=23169397 polypeptide=Lus10036257 locus=Lus10036257.g ID=Lus10036257.BGIv1.0 annot-version=v1.0
ATGGCTCGTTTGATTTTCTTTGTATCTCTCATTTCCTTGTCGCTGGCAGCTTCTGAAGCAAGAGAGTTCATCGTCGGAGGAAAAGAGAGCAACACTTTTT
GGAAGGTTCCTAACGGCGATCGGACCAATCTTAATTACTGGGCAGAGCAAAACAGATTCTCAAAAGGAGATGTTCTCGTATGGAAAACCGTGGATATAAA
GGATACAGTGCTGGAAGTGAACAAGAAAGCGTACGACAGCTGCAACACGACGTCGGATTCGGTTAAAACGGTGGACGTGGAGTTCACTTTGGACCACTCG
GGACCGTTCTACTTCATCAGCGGATGCAAGAGTCACTGCAACAAAGGGCTGAAGCTGGAAGTGGTTGTTCTCAGTGACCATCACCGAGAATTACTTCTGG
TTCCGGCGCCGGCGCCAAGTGGATCGTACAAGGTTAGAGCTTTCGGATCGGTGGTCACGGGGGCGGCGTTCCTGTCTTTGTTGCTTCTGTGA
AA sequence
>Lus10036257 pacid=23169397 polypeptide=Lus10036257 locus=Lus10036257.g ID=Lus10036257.BGIv1.0 annot-version=v1.0
MARLIFFVSLISLSLAASEAREFIVGGKESNTFWKVPNGDRTNLNYWAEQNRFSKGDVLVWKTVDIKDTVLEVNKKAYDSCNTTSDSVKTVDVEFTLDHS
GPFYFISGCKSHCNKGLKLEVVVLSDHHRELLLVPAPAPSGSYKVRAFGSVVTGAAFLSLLLL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G25060 AtENODL14 early nodulin-like protein 14 ... Lus10036257 0 1

Lus10036257 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.