Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G19790 74 / 5e-17 AP2_ERF RAP2.11 related to AP2 11 (.1) AT4G23750 65 / 3e-13 AP2_ERF TMO3, CRF2 TARGET OF MONOPTEROS 3, cytokinin response factor 2 (.1.2) AT4G11140 63 / 1e-12 AP2_ERF CRF1 cytokinin response factor 1 (.1) AT1G28360 59 / 2e-11 AP2_ERF AtERF12 ERF domain protein 12 (.1) AT3G61630 59 / 2e-11 AP2_ERF CRF6 cytokinin response factor 6 (.1) AT5G18560 59 / 3e-11 AP2_ERF PUCHI Integrase-type DNA-binding superfamily protein (.1) AT5G53290 58 / 7e-11 AP2_ERF CRF3 cytokinin response factor 3 (.1) AT1G22190 58 / 8e-11 AP2_ERF RAP2.4 related to AP2 4, Integrase-type DNA-binding superfamily protein (.1) AT1G28370 56 / 1e-10 AP2_ERF AtERF11 ERF domain protein 11 (.1) AT5G44210 56 / 2e-10 AP2_ERF AtERF9, ATERF-9 ERF DOMAIN PROTEIN- 9, erf domain protein 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041372 [exp] 133 / 6e-41 AT5G19790 102 / 1e-27 related to AP2 11 (.1) Lus10036793 [exp] 81 / 1e-18 AT5G19790 115 / 4e-29 related to AP2 11 (.1) Lus10037137 [exp] 80 / 2e-18 AT5G19790 116 / 2e-29 related to AP2 11 (.1) Lus10001298 [exp] 75 / 5e-18 AT5G19790 118 / 1e-33 related to AP2 11 (.1) Lus10008291 [exp] 78 / 9e-18 AT5G19790 106 / 3e-26 related to AP2 11 (.1) Lus10030430 [exp] 77 / 2e-17 AT5G19790 115 / 1e-29 related to AP2 11 (.1) Lus10012703 [exp] 77 / 2e-17 AT5G19790 119 / 3e-31 related to AP2 11 (.1) Lus10039171 [exp] 73 / 5e-16 AT5G19790 133 / 3e-37 related to AP2 11 (.1) Lus10013764 [exp] 72 / 7e-16 AT5G19790 132 / 6e-37 related to AP2 11 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G076702 [exp] 108 / 9e-30 AT5G19790 74 / 5e-15 related to AP2 11 (.1) Potri.002G153500 [exp] 103 / 1e-27 AT5G19790 79 / 6e-17 related to AP2 11 (.1) Potri.001G453100 [exp] 78 / 5e-18 AT5G19790 71 / 5e-14 related to AP2 11 (.1) Potri.017G087800 [exp] 75 / 9e-17 AT5G19790 89 / 3e-20 related to AP2 11 (.1) Potri.008G091300 [exp] 75 / 1e-16 AT5G19790 80 / 5e-17 related to AP2 11 (.1) Potri.003G220200 [exp] 73 / 2e-16 AT5G19790 164 / 1e-49 related to AP2 11 (.1) Potri.013G056700 [exp] 71 / 1e-15 AT5G19790 105 / 4e-27 related to AP2 11 (.1) Potri.011G148900 [exp] 71 / 1e-15 AT5G19790 65 / 5e-12 related to AP2 11 (.1) Potri.019G036100 [exp] 69 / 7e-15 AT5G19790 98 / 3e-24 related to AP2 11 (.1) Potri.001G004700 [exp] 69 / 9e-15 AT5G19790 112 / 1e-29 related to AP2 11 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10036556 pacid=23174373 polypeptide=Lus10036556 locus=Lus10036556.g ID=Lus10036556.BGIv1.0 annot-version=v1.0 ATGGCAGGAAACATTCCAGTACACGCCCAGATCAGCACCACCACCGCCGTGAAACCCCGCCGGTTCGTCGGAGTTAGGCAGAGGCCTTCCGGGAGATGGG TTGCCGAAATCAAAGACTCCTCCCAGCGTGTCAGGCTATGGCTTGGAACCTACGACACCCCTGAAGAAGCCGCCAGAGCTTATGACGAAGCTGCCCGCGC CCTCCGCGGCGAGAATGCTCGCACCAATTTCGCCTCCTCTTCCGATTCCAAGACCGCCACAACCAACGGATCGTCACCCTCAGCGGCTTCTTCCCTGGCG TCCCCGACTCCGAAACCTTTCTCTTCTCTTCAGGCGGAGCTGAGCAAAAATATGCAGAAGATTATGGCTAGGAATAATGGCAAGGACTAG
AA sequence Show only first row Show all	>Lus10036556 pacid=23174373 polypeptide=Lus10036556 locus=Lus10036556.g ID=Lus10036556.BGIv1.0 annot-version=v1.0 MAGNIPVHAQISTTTAVKPRRFVGVRQRPSGRWVAEIKDSSQRVRLWLGTYDTPEEAARAYDEAARALRGENARTNFASSSDSKTATTNGSSPSAASSLA SPTPKPFSSLQAELSKNMQKIMARNNGKD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G19790	AP2_ERF	RAP2.11	related to AP2 11 (.1)		Lus10036556 [exp]	0	1
AT1G61800		ATGPT2, GPT2	ARABIDOPSIS GLUCOSE-6-PHOSPHAT...		Lus10007653 [exp]	3.3	0.8921
					Lus10036557 [exp]	9.0	0.8753
					Lus10042011 [exp]	9.7	0.8825
AT5G06920		FLA21	FASCICLIN-like arabinogalactan...		Lus10019675 [exp]	13.2	0.8609
					Lus10041371 [exp]	17.9	0.8398
AT2G28790			Pathogenesis-related thaumatin...		Lus10040843 [exp]	18.5	0.8594
AT5G17390			Adenine nucleotide alpha hydro...		Lus10034661 [exp]	19.0	0.8641
AT2G38600			HAD superfamily, subfamily III...		Lus10017060 [exp]	19.4	0.8533
AT3G08640			Protein of unknown function (D...		Lus10035607 [exp]	22.4	0.8561
AT1G67330			Protein of unknown function (D...		Lus10037026 [exp]	24.1	0.8531

Compare expression of checked genes

Lus10036556 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.