Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G15240 76 / 1e-17 Transmembrane amino acid transporter family protein (.1.2) AT3G28960 73 / 1e-16 Transmembrane amino acid transporter family protein (.1) AT2G41190 66 / 6e-14 Transmembrane amino acid transporter family protein (.1) AT2G39130 58 / 3e-11 Transmembrane amino acid transporter family protein (.1) AT5G02170 57 / 8e-11 Transmembrane amino acid transporter family protein (.1.2) AT3G09330 55 / 4e-10 Transmembrane amino acid transporter family protein (.1) AT5G02180 54 / 5e-10 Transmembrane amino acid transporter family protein (.1) AT3G09340 54 / 7e-10 Transmembrane amino acid transporter family protein (.1) AT3G54830 49 / 6e-08 Transmembrane amino acid transporter family protein (.1) AT5G16740 39 / 0.0002 Transmembrane amino acid transporter family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030469 [exp] 139 / 6e-41 AT5G15240 405 / 4e-139 Transmembrane amino acid transporter family protein (.1.2) Lus10012824 [exp] 137 / 2e-40 AT5G15240 425 / 3e-147 Transmembrane amino acid transporter family protein (.1.2) Lus10023029 [exp] 95 / 1e-24 AT3G28960 280 / 6e-92 Transmembrane amino acid transporter family protein (.1) Lus10030683 [exp] 73 / 2e-16 AT5G15240 510 / 2e-180 Transmembrane amino acid transporter family protein (.1.2) Lus10005239 [exp] 72 / 3e-16 AT5G15240 509 / 4e-180 Transmembrane amino acid transporter family protein (.1.2) Lus10039190 [exp] 56 / 2e-10 AT2G39130 652 / 0.0 Transmembrane amino acid transporter family protein (.1) Lus10010855 [exp] 52 / 4e-09 AT5G02170 501 / 2e-171 Transmembrane amino acid transporter family protein (.1.2) Lus10024374 [exp] 49 / 4e-08 AT5G02180 446 / 4e-152 Transmembrane amino acid transporter family protein (.1) Lus10010457 [exp] 46 / 7e-07 AT5G04140 2772 / 0.0 FERREDOXIN-DEPENDENT GLUTAMATE SYNTHASE 1, FERREDOXIN-DEPENDENT GLUTAMATE SYNTHASE, glutamate synthase 1 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G086500 [exp] 104 / 4e-28 AT3G28960 411 / 4e-142 Transmembrane amino acid transporter family protein (.1) Potri.010G169000 [exp] 98 / 1e-25 AT3G28960 381 / 2e-130 Transmembrane amino acid transporter family protein (.1) Potri.017G083500 [exp] 73 / 2e-16 AT5G15240 448 / 4e-156 Transmembrane amino acid transporter family protein (.1.2) Potri.017G083700 [exp] 72 / 3e-16 AT3G28960 456 / 2e-159 Transmembrane amino acid transporter family protein (.1) Potri.018G099700 [exp] 69 / 4e-15 AT3G28960 348 / 6e-118 Transmembrane amino acid transporter family protein (.1) Potri.010G226000 [exp] 64 / 2e-13 AT2G39130 708 / 0.0 Transmembrane amino acid transporter family protein (.1) Potri.016G100300 [exp] 61 / 3e-12 AT5G02180 587 / 0.0 Transmembrane amino acid transporter family protein (.1) Potri.008G036300 [exp] 58 / 4e-11 AT2G39130 691 / 0.0 Transmembrane amino acid transporter family protein (.1) Potri.006G038700 [exp] 39 / 0.0001 AT2G41190 459 / 9e-159 Transmembrane amino acid transporter family protein (.1) Potri.015G091600 [exp] 38 / 0.0003 AT5G40780 610 / 0.0 lysine histidine transporter 1 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0062 [flax] [poplar] APC PF01490 [flax] [poplar] Aa_trans Transmembrane amino acid transporter protein
Representative CDS sequence Show only first row Show all	>Lus10036755 pacid=23171325 polypeptide=Lus10036755 locus=Lus10036755.g ID=Lus10036755.BGIv1.0 annot-version=v1.0 ATGGGCTACCTCATGTTTGGAGACCATCTAAACTCACAAGTCACATTGAACCTCCCTATCGTGAAACTTGGTTTCAAAGTCGCGATCTACATCATGTTGG TCAATCTTGTGACCAAGTATGTGGTGATCGTCGCTCCGATTACGAGTGCAATGGAGGAAAAGTTTGTCTTCCAAGACAACATTCTTCTTAGTGTCCTTAC TCAGACGGGGATCGTGGTCAGCACGGTGATCATGGCCATAACTGTGTCATTCTTTGGCAACATGATGGCATTCTGA
AA sequence Show only first row Show all	>Lus10036755 pacid=23171325 polypeptide=Lus10036755 locus=Lus10036755.g ID=Lus10036755.BGIv1.0 annot-version=v1.0 MGYLMFGDHLNSQVTLNLPIVKLGFKVAIYIMLVNLVTKYVVIVAPITSAMEEKFVFQDNILLSVLTQTGIVVSTVIMAITVSFFGNMMAF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G15240			Transmembrane amino acid trans...		Lus10036755 [exp]	0	1

Compare expression of checked genes

Lus10036755 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.