Lus10036956 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G39830 136 / 8e-38 Cupredoxin superfamily protein (.1)
AT5G21105 94 / 4e-23 Plant L-ascorbate oxidase (.1.2.3)
AT5G21100 91 / 1e-21 Plant L-ascorbate oxidase (.1)
AT5G05390 54 / 9e-09 LAC12 laccase 12 (.1)
AT1G76160 45 / 8e-06 SKS5 SKU5 similar 5 (.1)
AT1G55570 45 / 1e-05 SKS12 SKU5 similar 12 (.1)
AT2G46570 44 / 2e-05 LAC6 laccase 6 (.1)
AT2G40370 44 / 2e-05 LAC5 laccase 5 (.1)
AT5G48100 43 / 4e-05 LAC15, TT10, ATLAC15 TRANSPARENT TESTA 10, LACCASE-LIKE 15, Laccase/Diphenol oxidase family protein (.1)
AT1G21850 42 / 0.0001 SKS8 SKU5 similar 8 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037103 131 / 4e-39 AT4G39830 121 / 2e-32 Cupredoxin superfamily protein (.1)
Lus10022504 139 / 9e-39 AT4G39830 828 / 0.0 Cupredoxin superfamily protein (.1)
Lus10016808 139 / 1e-38 AT4G39830 824 / 0.0 Cupredoxin superfamily protein (.1)
Lus10026753 100 / 1e-24 AT5G21105 787 / 0.0 Plant L-ascorbate oxidase (.1.2.3)
Lus10025538 99 / 2e-24 AT5G21105 792 / 0.0 Plant L-ascorbate oxidase (.1.2.3)
Lus10017426 55 / 5e-09 AT2G40370 805 / 0.0 laccase 5 (.1)
Lus10007532 53 / 2e-08 AT2G40370 804 / 0.0 laccase 5 (.1)
Lus10009841 51 / 8e-08 AT5G05390 811 / 0.0 laccase 12 (.1)
Lus10026401 51 / 1e-07 AT2G30210 518 / 0.0 laccase 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G171700 154 / 2e-44 AT4G39830 799 / 0.0 Cupredoxin superfamily protein (.1)
Potri.007G088358 147 / 4e-42 AT4G39830 831 / 0.0 Cupredoxin superfamily protein (.1)
Potri.007G088222 147 / 7e-42 AT4G39830 847 / 0.0 Cupredoxin superfamily protein (.1)
Potri.005G079400 147 / 8e-42 AT4G39830 828 / 0.0 Cupredoxin superfamily protein (.1)
Potri.001G454700 112 / 3e-29 AT4G39830 619 / 0.0 Cupredoxin superfamily protein (.1)
Potri.009G159700 105 / 7e-27 AT5G21105 760 / 0.0 Plant L-ascorbate oxidase (.1.2.3)
Potri.001G219300 97 / 6e-24 AT5G21105 758 / 0.0 Plant L-ascorbate oxidase (.1.2.3)
Potri.010G183500 50 / 2e-07 AT5G05390 915 / 0.0 laccase 12 (.1)
Potri.004G010100 45 / 1e-05 AT4G22010 844 / 0.0 SKU5 similar 4 (.1)
Potri.007G023300 45 / 1e-05 AT5G03260 889 / 0.0 laccase 11 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF00394 Cu-oxidase Multicopper oxidase
Representative CDS sequence
>Lus10036956 pacid=23171009 polypeptide=Lus10036956 locus=Lus10036956.g ID=Lus10036956.BGIv1.0 annot-version=v1.0
ATGCTGAGGCAGGATCACAAGATGACGGTGGGGGAAGCCGACGGGAACTACGTGGAACCATCCGAGACGGAGAACCTCTACGTCTACTCCGGGGAGACCT
ACTCCGTGTTGGTGAAAGCCGATCAGCCTCCGACGAGGAATTACTGGATCACCACGAGCGTCGTCTCTCGGAAACCTTCAACTCCGGCACGTATCGCAAT
TCTCAACTACTACCCGAACCACTCGCGGCGTTGTCCTCATACTGTCCCGCCAGCTGGACCTCAATGGAACGACACCGTATCACGCCTGGAACGGAGTCAG
GCATTTAAGACCCGGAAAGGCTACGTCCACGAACCGCCTCCGACCGGACCGGGTCATCCAGCTACTCAACACGCAGAACAAGATTGGAGCGAAATTCAAA
TAGGCGTTGAACAATCTCTCCCTTGCCCTCTCAACGACTCCTTACTTGATCCCCCTGAAGTGAAACCTGAAGGGCATTTTCGATCAGGATTCGCCTCCGG
AGAAATTTGA
AA sequence
>Lus10036956 pacid=23171009 polypeptide=Lus10036956 locus=Lus10036956.g ID=Lus10036956.BGIv1.0 annot-version=v1.0
MLRQDHKMTVGEADGNYVEPSETENLYVYSGETYSVLVKADQPPTRNYWITTSVVSRKPSTPARIAILNYYPNHSRRCPHTVPPAGPQWNDTVSRLERSQ
AFKTRKGYVHEPPPTGPGHPATQHAEQDWSEIQIGVEQSLPCPLNDSLLDPPEVKPEGHFRSGFASGEI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G39830 Cupredoxin superfamily protein... Lus10036956 0 1
AT1G47720 OSB1 Organellar Single-stranded, Pr... Lus10032760 30.3 0.7146
AT5G05140 Transcription elongation facto... Lus10039000 34.1 0.7930
Lus10012525 48.0 0.7845
AT1G69490 NAC NAP, ANAC029, A... Arabidopsis NAC domain contain... Lus10036773 49.0 0.7645
AT3G50980 XERO1 dehydrin xero 1 (.1) Lus10014280 55.9 0.7784
AT1G79750 ATNADP-ME4 Arabidopsis thaliana NADP-mali... Lus10014149 60.6 0.7663
AT3G22490 Seed maturation protein (.1) Lus10015948 92.0 0.6878
AT4G12010 Disease resistance protein (TI... Lus10017419 92.8 0.7247
AT5G49650 XK2, XK-2 XYLULOSE KINASE 2, xylulose ki... Lus10028235 106.3 0.7378
Lus10024788 133.7 0.7271

Lus10036956 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.