Lus10036957 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G39830 215 / 8e-68 Cupredoxin superfamily protein (.1)
AT5G21105 174 / 1e-53 Plant L-ascorbate oxidase (.1.2.3)
AT5G21100 166 / 4e-49 Plant L-ascorbate oxidase (.1)
AT5G03260 122 / 2e-33 LAC11 laccase 11 (.1)
AT5G01190 118 / 9e-32 LAC10 laccase 10 (.1)
AT5G07130 118 / 1e-31 LAC13 laccase 13 (.1)
AT5G01050 117 / 2e-31 Laccase/Diphenol oxidase family protein (.1)
AT1G18140 117 / 3e-31 LAC1, ATLAC1 laccase 1 (.1)
AT5G01040 115 / 1e-30 LAC8 laccase 8 (.1)
AT2G30210 114 / 2e-30 LAC3 laccase 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009603 298 / 4e-100 AT4G39830 754 / 0.0 Cupredoxin superfamily protein (.1)
Lus10000871 287 / 5e-96 AT4G39830 756 / 0.0 Cupredoxin superfamily protein (.1)
Lus10022504 217 / 2e-68 AT4G39830 828 / 0.0 Cupredoxin superfamily protein (.1)
Lus10016808 212 / 1e-66 AT4G39830 824 / 0.0 Cupredoxin superfamily protein (.1)
Lus10026753 156 / 2e-45 AT5G21105 787 / 0.0 Plant L-ascorbate oxidase (.1.2.3)
Lus10025538 152 / 3e-43 AT5G21105 792 / 0.0 Plant L-ascorbate oxidase (.1.2.3)
Lus10023189 124 / 8e-34 AT5G03260 930 / 0.0 laccase 11 (.1)
Lus10002227 124 / 1e-33 AT5G03260 926 / 0.0 laccase 11 (.1)
Lus10026512 123 / 2e-33 AT5G03260 919 / 0.0 laccase 11 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G088358 231 / 7e-74 AT4G39830 831 / 0.0 Cupredoxin superfamily protein (.1)
Potri.007G088222 229 / 4e-73 AT4G39830 847 / 0.0 Cupredoxin superfamily protein (.1)
Potri.010G171700 228 / 5e-73 AT4G39830 799 / 0.0 Cupredoxin superfamily protein (.1)
Potri.005G079400 216 / 4e-68 AT4G39830 828 / 0.0 Cupredoxin superfamily protein (.1)
Potri.001G454700 187 / 2e-57 AT4G39830 619 / 0.0 Cupredoxin superfamily protein (.1)
Potri.001G219300 160 / 5e-47 AT5G21105 758 / 0.0 Plant L-ascorbate oxidase (.1.2.3)
Potri.009G159700 157 / 9e-46 AT5G21105 760 / 0.0 Plant L-ascorbate oxidase (.1.2.3)
Potri.009G102700 127 / 8e-35 AT5G03260 881 / 0.0 laccase 11 (.1)
Potri.007G023300 124 / 8e-34 AT5G03260 889 / 0.0 laccase 11 (.1)
Potri.004G156400 122 / 2e-33 AT5G03260 877 / 0.0 laccase 11 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF07731 Cu-oxidase_2 Multicopper oxidase
Representative CDS sequence
>Lus10036957 pacid=23171243 polypeptide=Lus10036957 locus=Lus10036957.g ID=Lus10036957.BGIv1.0 annot-version=v1.0
ATGTCGGATTATGACATTTACAGTGTGGCGAAGAACGTGAACGCTACGCTGAGCAACCGGATTTACAAGCTGGAATTCAATTCCACGATGGATGTTATGT
TACAGAATGCCAACACAATGACGCCTAACAATAGTGAAGCGCACCCTTGGCATCTCCACGGGCATGATTTTTGGGTGCTCGCGTATGGGGAAGGGAACTG
TGACCCAACCCGGGATATGGAGAGGTATAACCTTGTGGATCCGGTGATGAAGAATATAGTGCCGCTTCATCCTTATGGGTGGACCGCGATTCGGTTCAGG
GCAGATAACCCGGGTCTGTGGTTCTTCCATTGCCACATTGAGTCTCATTTCTTCATGGGAATGGTTTTGGTTTTCCAAGAAGCGAGTTGGATGGTTGGAC
GGCTGCCTTCTTCAGTTATGGGATGTGGGAAAACCAAACCGGCCGTTTGA
AA sequence
>Lus10036957 pacid=23171243 polypeptide=Lus10036957 locus=Lus10036957.g ID=Lus10036957.BGIv1.0 annot-version=v1.0
MSDYDIYSVAKNVNATLSNRIYKLEFNSTMDVMLQNANTMTPNNSEAHPWHLHGHDFWVLAYGEGNCDPTRDMERYNLVDPVMKNIVPLHPYGWTAIRFR
ADNPGLWFFHCHIESHFFMGMVLVFQEASWMVGRLPSSVMGCGKTKPAV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G39830 Cupredoxin superfamily protein... Lus10036957 0 1
AT1G29680 Protein of unknown function (D... Lus10005415 23.3 0.8736
AT1G80160 GLYI7 glyoxylase I 7, Lactoylglutath... Lus10014480 35.4 0.8713
AT3G50120 Plant protein of unknown funct... Lus10004515 39.0 0.8651
AT3G21510 ATHP3, AHP1 histidine-containing phosphotr... Lus10002256 41.4 0.8642
AT5G05220 unknown protein Lus10034248 45.2 0.8150
AT3G16350 MYB Homeodomain-like superfamily p... Lus10006826 50.4 0.8592
AT5G45690 Protein of unknown function (D... Lus10005416 57.2 0.8592
AT1G02040 C2H2ZnF C2H2-type zinc finger family p... Lus10028173 67.6 0.8557
AT4G33495 RPD1 ROOT PRIMORDIUM DEFECTIVE 1, U... Lus10005755 84.4 0.8499
AT3G61610 Galactose mutarotase-like supe... Lus10003035 94.0 0.8408

Lus10036957 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.