Lus10037103 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G39830 116 / 1e-30 Cupredoxin superfamily protein (.1)
AT5G21105 92 / 2e-22 Plant L-ascorbate oxidase (.1.2.3)
AT5G21100 92 / 6e-22 Plant L-ascorbate oxidase (.1)
AT1G55570 59 / 1e-10 SKS12 SKU5 similar 12 (.1)
AT3G13400 52 / 5e-08 SKS13 SKU5 similar 13 (.1)
AT1G21850 49 / 6e-07 SKS8 SKU5 similar 8 (.1)
AT5G51480 48 / 9e-07 SKS2 SKU5 similar 2 (.1)
AT3G13390 48 / 1e-06 SKS11 SKU5 similar 11 (.1)
AT1G21860 44 / 3e-05 SKS7 SKU5 similar 7 (.1)
AT1G76160 43 / 6e-05 SKS5 SKU5 similar 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009603 177 / 7e-53 AT4G39830 754 / 0.0 Cupredoxin superfamily protein (.1)
Lus10000871 174 / 7e-52 AT4G39830 756 / 0.0 Cupredoxin superfamily protein (.1)
Lus10036956 132 / 2e-39 AT4G39830 136 / 6e-40 Cupredoxin superfamily protein (.1)
Lus10022504 122 / 2e-32 AT4G39830 828 / 0.0 Cupredoxin superfamily protein (.1)
Lus10016808 122 / 2e-32 AT4G39830 824 / 0.0 Cupredoxin superfamily protein (.1)
Lus10025538 99 / 4e-24 AT5G21105 792 / 0.0 Plant L-ascorbate oxidase (.1.2.3)
Lus10026753 95 / 7e-23 AT5G21105 787 / 0.0 Plant L-ascorbate oxidase (.1.2.3)
Lus10037106 49 / 2e-07 AT3G04070 78 / 3e-17 NAC domain containing protein 47 (.1.2)
Lus10021864 48 / 9e-07 AT1G55570 814 / 0.0 SKU5 similar 12 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G171700 135 / 2e-37 AT4G39830 799 / 0.0 Cupredoxin superfamily protein (.1)
Potri.007G088222 123 / 6e-33 AT4G39830 847 / 0.0 Cupredoxin superfamily protein (.1)
Potri.007G088358 120 / 3e-32 AT4G39830 831 / 0.0 Cupredoxin superfamily protein (.1)
Potri.005G079400 119 / 9e-32 AT4G39830 828 / 0.0 Cupredoxin superfamily protein (.1)
Potri.001G454700 105 / 2e-26 AT4G39830 619 / 0.0 Cupredoxin superfamily protein (.1)
Potri.009G159700 98 / 4e-24 AT5G21105 760 / 0.0 Plant L-ascorbate oxidase (.1.2.3)
Potri.001G219300 94 / 1e-22 AT5G21105 758 / 0.0 Plant L-ascorbate oxidase (.1.2.3)
Potri.001G000500 54 / 9e-09 AT1G55570 853 / 0.0 SKU5 similar 12 (.1)
Potri.001G000600 52 / 5e-08 AT1G55570 850 / 0.0 SKU5 similar 12 (.1)
Potri.003G224100 51 / 8e-08 AT1G55570 855 / 0.0 SKU5 similar 12 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF00394 Cu-oxidase Multicopper oxidase
Representative CDS sequence
>Lus10037103 pacid=23152302 polypeptide=Lus10037103 locus=Lus10037103.g ID=Lus10037103.BGIv1.0 annot-version=v1.0
ATGGAAGCCGATGGTGGTGTAGACTATAGGCTCCTCCTTCTGCAACCTCCACATGAAGTTTCCGAAGCTCCTCTCGACTCGCTTGCCCTTCTCGTTCCTC
TTCTTCTTTTGCTTGGTGAAGAAGAAGAGCTCCGACTAGTTGACCTCGCTCTCGAAGTGTCTCTTCCATGGCTCGTCGGGGGTGTAACACCCCAAGGTCA
CAAGATGACGGTGATGGAAGCCGACGGGAACTACGTGGAACTATTCGACACGGAGGTCTACTCCGGCGAGACCTACTCCGTGTTGGTGAAAGCCGATCAG
CCTCCAACGAGGAATTACTGGATCACCACGAGCGTCGTCGCTCGGAAACCTTCAACTCCGGCTGGTATCGCAATTCTCAACTACGGTCCCGCCAGCTGGA
CCTCAATGGAACAGAGTCGGGCATTTAAGGCCCGGAAAGGCTACGTCCACAAACCGCCTCCGAAACTGGACCGGGTCATCAAGCTACTCAACACGCAGAA
CAAGATTGGAGGGAAATTCAAATGTTGA
AA sequence
>Lus10037103 pacid=23152302 polypeptide=Lus10037103 locus=Lus10037103.g ID=Lus10037103.BGIv1.0 annot-version=v1.0
MEADGGVDYRLLLLQPPHEVSEAPLDSLALLVPLLLLLGEEEELRLVDLALEVSLPWLVGGVTPQGHKMTVMEADGNYVELFDTEVYSGETYSVLVKADQ
PPTRNYWITTSVVARKPSTPAGIAILNYGPASWTSMEQSRAFKARKGYVHKPPPKLDRVIKLLNTQNKIGGKFKC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G39830 Cupredoxin superfamily protein... Lus10037103 0 1
AT4G35150 O-methyltransferase family pro... Lus10012408 3.3 0.8129
Lus10024679 3.5 0.7617
Lus10023538 4.2 0.7477
AT4G12410 SAUR-like auxin-responsive pro... Lus10004337 4.5 0.7295
AT3G04070 NAC ANAC047 NAC domain containing protein ... Lus10027357 8.9 0.7539
AT4G35210 Arabidopsis protein of unknown... Lus10023951 11.3 0.7341
AT1G30840 ATPUP4 purine permease 4 (.1.2) Lus10002868 12.6 0.6655
AT2G03430 Ankyrin repeat family protein ... Lus10036968 25.0 0.6894
AT3G26040 HXXXD-type acyl-transferase fa... Lus10025522 25.7 0.6536
AT5G12890 UDP-Glycosyltransferase superf... Lus10025514 31.6 0.7115

Lus10037103 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.