Lus10037597 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G58290 419 / 1e-148 RPT3 regulatory particle triple-A ATPase 3 (.1)
AT4G29040 246 / 2e-80 RPT2A regulatory particle AAA-ATPase 2A (.1)
AT2G20140 244 / 1e-79 RPT2b regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1)
AT5G19990 213 / 7e-68 ATSUG1, RPT6A regulatory particle triple-A ATPase 6A (.1)
AT5G20000 213 / 1e-67 RPT6A AAA-type ATPase family protein (.1)
AT1G53750 211 / 1e-66 RPT1A regulatory particle triple-A 1A (.1)
AT3G05530 202 / 2e-63 ATS6A.2, RPT5A regulatory particle triple-A ATPase 5A (.1)
AT1G09100 200 / 1e-62 RPT5B 26S proteasome AAA-ATPase subunit RPT5B (.1)
AT1G45000 199 / 2e-62 AAA-type ATPase family protein (.1.2)
AT5G43010 197 / 6e-62 RPT4A regulatory particle triple-A ATPase 4A (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006854 421 / 2e-150 AT5G58290 526 / 0.0 regulatory particle triple-A ATPase 3 (.1)
Lus10015524 245 / 4e-81 AT2G20140 659 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1)
Lus10006976 240 / 7e-78 AT4G29040 828 / 0.0 regulatory particle AAA-ATPase 2A (.1)
Lus10011901 242 / 3e-77 AT2G20140 844 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1)
Lus10019995 245 / 5e-76 AT2G20140 827 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1)
Lus10017762 212 / 2e-67 AT5G19990 797 / 0.0 regulatory particle triple-A ATPase 6A (.1)
Lus10031815 212 / 8e-67 AT1G53750 828 / 0.0 regulatory particle triple-A 1A (.1)
Lus10031243 211 / 1e-65 AT1G53750 841 / 0.0 regulatory particle triple-A 1A (.1)
Lus10001313 202 / 8e-64 AT4G29040 673 / 0.0 regulatory particle AAA-ATPase 2A (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G028000 419 / 1e-148 AT5G58290 781 / 0.0 regulatory particle triple-A ATPase 3 (.1)
Potri.006G031000 417 / 4e-148 AT5G58290 771 / 0.0 regulatory particle triple-A ATPase 3 (.1)
Potri.014G194700 248 / 4e-81 AT4G29040 829 / 0.0 regulatory particle AAA-ATPase 2A (.1)
Potri.002G252600 246 / 2e-80 AT4G29040 838 / 0.0 regulatory particle AAA-ATPase 2A (.1)
Potri.006G216600 211 / 7e-67 AT1G53750 804 / 0.0 regulatory particle triple-A 1A (.1)
Potri.018G056600 211 / 9e-67 AT1G53750 803 / 0.0 regulatory particle triple-A 1A (.1)
Potri.008G144100 211 / 1e-66 AT5G19990 741 / 0.0 regulatory particle triple-A ATPase 6A (.1)
Potri.001G161700 209 / 3e-66 AT1G53750 809 / 0.0 regulatory particle triple-A 1A (.1)
Potri.010G098300 208 / 1e-65 AT5G19990 768 / 0.0 regulatory particle triple-A ATPase 6A (.1)
Potri.005G025100 201 / 3e-63 AT3G05530 795 / 0.0 regulatory particle triple-A ATPase 5A (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00004 AAA ATPase family associated with various cellular activities (AAA)
Representative CDS sequence
>Lus10037597 pacid=23167150 polypeptide=Lus10037597 locus=Lus10037597.g ID=Lus10037597.BGIv1.0 annot-version=v1.0
ATGCTTGCTAAGGCAGTTGCCAATCACACTACAGCAGCTTTCATAAGAGTTGTTGGGTCTGAGTTTGTGCAGAAGTATTTGGGAGAGGGCCCTCGCATGG
TCCGTGATGTTTTCCGTCTTGCCAAAGAGAATGCTCCTGCAATTATTTTTATAGATGAAGTGGATGCTATTGCTACGGCTAGGTTTGATGCACAGACAGG
AGCTGATAGAGAAGTTCAACGTATCCTGATGGAGCTTCTGAATCAGATGGACGGGTTTGATCAGACTGTGAATGTAAAGGTTATAATGGCAACTAATCGT
GCCGATACACTGGACCCTGCACTCCTTCGTCCTGGAAGGCTGGACCGAAAAATCGAATTCCCTCTGCCTGATAGACGTCAGAAAAGGCTAGTTTTCCAGG
TTTGCACTGCTAAAATGAATCTCAGTGACGAGGTTGATTTGGAGGATTATGTGTCGAGGCCAGATAAAATTAGCGCTGCCGAGATCTCGGCCATCTGCCA
GGAAGCAGGGATGCACGCTGTAAGGAAGAACAGGTACGTGATACTGCCCAAGGACTTCGAGAAGGGTTACCGTTCCAACGTGAAGAAGCCCGATACCGAT
TTCGAGTTCTACAAGTAA
AA sequence
>Lus10037597 pacid=23167150 polypeptide=Lus10037597 locus=Lus10037597.g ID=Lus10037597.BGIv1.0 annot-version=v1.0
MLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR
ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAEISAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTD
FEFYK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G58290 RPT3 regulatory particle triple-A A... Lus10037597 0 1
AT5G65720 ATNIFS1, NIFS1 ... NITROGEN FIXATION S HOMOLOG 1,... Lus10019252 1.0 0.9219
AT5G03340 ATPase, AAA-type, CDC48 protei... Lus10021441 1.4 0.8986
AT4G11150 TUFF, EMB2448, ... embryo defective 2448, vacuola... Lus10032349 4.9 0.8855
AT4G15248 CO B-box type zinc finger family ... Lus10039694 12.1 0.8971
AT1G75230 DNA glycosylase superfamily pr... Lus10033215 15.2 0.8697
AT1G74310 HOT1, ATHSP101 heat shock protein 101 (.1) Lus10040528 16.6 0.8840
AT1G47056 VFB1 VIER F-box proteine 1 (.1) Lus10018737 16.7 0.8586
AT3G15610 Transducin/WD40 repeat-like su... Lus10019450 17.3 0.8504
AT2G36300 Integral membrane Yip1 family ... Lus10021374 19.1 0.8795
AT2G29900 PS2 Presenilin-2 (.1) Lus10031966 19.3 0.8502

Lus10037597 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.