Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30220 173 / 2e-58 RUXF small nuclear ribonucleoprotein F (.1.2) AT2G14285 118 / 6e-37 Small nuclear ribonucleoprotein family protein (.1) AT2G43810 68 / 2e-16 Small nuclear ribonucleoprotein family protein (.1.2) AT3G59810 67 / 3e-16 Small nuclear ribonucleoprotein family protein (.1) AT5G27720 38 / 0.0002 LSM4, EMB1644 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006867 [exp] 127 / 4e-40 AT4G30220 119 / 4e-37 small nuclear ribonucleoprotein F (.1.2) Lus10026860 [exp] 65 / 1e-13 AT5G36890 189 / 2e-56 beta glucosidase 42 (.1.2) Lus10004221 [exp] 40 / 5e-05 AT5G27720 182 / 2e-57 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10029426 [exp] 39 / 0.0001 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G092200 [exp] 176 / 1e-59 AT4G30220 155 / 2e-51 small nuclear ribonucleoprotein F (.1.2) Potri.006G167000 [exp] 92 / 3e-26 AT2G14285 62 / 1e-14 Small nuclear ribonucleoprotein family protein (.1) Potri.010G178700 [exp] 71 / 2e-17 AT2G43810 150 / 4e-49 Small nuclear ribonucleoprotein family protein (.1.2) Potri.008G078400 [exp] 69 / 7e-17 AT2G43810 166 / 2e-55 Small nuclear ribonucleoprotein family protein (.1.2) Potri.002G205700 [exp] 38 / 0.0002 AT5G27720 179 / 5e-59 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Potri.004G219000 [exp] 37 / 0.0002 AT1G03330 184 / 1e-62 Small nuclear ribonucleoprotein family protein (.1) Potri.003G014900 [exp] 37 / 0.0002 AT1G03330 184 / 1e-62 Small nuclear ribonucleoprotein family protein (.1) Potri.014G130700 [exp] 37 / 0.0005 AT5G27720 176 / 7e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [flax] [poplar] Sm-like PF01423 [flax] [poplar] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Lus10037606 pacid=23167314 polypeptide=Lus10037606 locus=Lus10037606.g ID=Lus10037606.BGIv1.0 annot-version=v1.0 ATGGCGACAGTACCAGTAAACCCTAAGCCGTTCTTGAACAACTTAACCGGGAAAACTGTGATCGTGAAGCTGAAATGGGGAATGGAATATAAAGGTTTTC TTGCTTCAGTTGATTCCTACATGAACCTGCAGCTAGGGAATGCTGAAGAGTATATCGACGGGCAGTTCACTGGGAATCTGGGAGAGATCTTGATAAGGTG CAACAATGTTCTCTACATGCGAGGAGTACCAGAAGACGAGGAAATAGAGGACGCTGATCGTGATTAG
AA sequence Show only first row Show all	>Lus10037606 pacid=23167314 polypeptide=Lus10037606 locus=Lus10037606.g ID=Lus10037606.BGIv1.0 annot-version=v1.0 MATVPVNPKPFLNNLTGKTVIVKLKWGMEYKGFLASVDSYMNLQLGNAEEYIDGQFTGNLGEILIRCNNVLYMRGVPEDEEIEDADRD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G30220		RUXF	small nuclear ribonucleoprotei...		Lus10037606 [exp]	0	1
AT5G02530			RNA-binding (RRM/RBD/RNP motif...		Lus10040851 [exp]	1.4	0.9002
AT1G11240			unknown protein		Lus10018438 [exp]	1.7	0.8960
AT5G20510	Alfin	AL5	alfin-like 5 (.1)		Lus10037655 [exp]	2.2	0.9043
AT3G59650			mitochondrial ribosomal protei...		Lus10006114 [exp]	2.8	0.8936
AT3G05070			unknown protein		Lus10042290 [exp]	3.7	0.8619
AT2G21240	BBR_BPC	BPC4, BBR/BPC4,...	basic pentacysteine 4 (.1.2)		Lus10031078 [exp]	3.9	0.8914
AT2G30260		U2B''	U2 small nuclear ribonucleopro...		Lus10026413 [exp]	4.1	0.8534
AT1G05205			unknown protein		Lus10027173 [exp]	4.2	0.8896
AT5G38890			Nucleic acid-binding, OB-fold-...		Lus10004763 [exp]	4.2	0.8662
AT2G26470			unknown protein		Lus10038230 [exp]	5.5	0.8648

Compare expression of checked genes

Lus10037606 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.