Lus10037998 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G08500 100 / 7e-26 AtENODL18 early nodulin-like protein 18 (.1)
AT5G15350 45 / 6e-06 AtENODL17 early nodulin-like protein 17 (.1)
AT3G20570 44 / 2e-05 AtENODL9 early nodulin-like protein 9 (.1)
AT3G27200 42 / 6e-05 Cupredoxin superfamily protein (.1)
AT5G26330 41 / 0.0002 Cupredoxin superfamily protein (.1)
AT3G17675 40 / 0.0002 Cupredoxin superfamily protein (.1)
AT2G31050 40 / 0.0005 Cupredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009231 251 / 1e-83 AT1G08500 117 / 4e-31 early nodulin-like protein 18 (.1)
Lus10036067 97 / 4e-24 AT1G08500 221 / 1e-72 early nodulin-like protein 18 (.1)
Lus10041570 47 / 1e-06 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1)
Lus10020944 45 / 1e-05 AT1G72230 141 / 1e-42 Cupredoxin superfamily protein (.1)
Lus10022350 44 / 3e-05 AT3G27200 169 / 7e-54 Cupredoxin superfamily protein (.1)
Lus10008720 43 / 6e-05 AT1G72230 140 / 2e-42 Cupredoxin superfamily protein (.1)
Lus10007026 42 / 7e-05 AT2G32300 96 / 4e-25 uclacyanin 1 (.1)
Lus10020276 42 / 0.0001 AT1G45063 116 / 9e-30 copper ion binding;electron carriers (.1.2)
Lus10002618 41 / 0.0001 AT3G27200 89 / 2e-23 Cupredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G150600 184 / 1e-58 AT1G08500 97 / 2e-24 early nodulin-like protein 18 (.1)
Potri.014G072700 166 / 2e-51 AT1G08500 92 / 1e-22 early nodulin-like protein 18 (.1)
Potri.001G273000 107 / 2e-28 AT1G08500 213 / 1e-69 early nodulin-like protein 18 (.1)
Potri.009G067300 99 / 2e-25 AT1G08500 207 / 2e-67 early nodulin-like protein 18 (.1)
Potri.014G049600 48 / 1e-06 AT3G60270 111 / 8e-31 Cupredoxin superfamily protein (.1)
Potri.002G101300 47 / 2e-06 AT1G72230 131 / 6e-39 Cupredoxin superfamily protein (.1)
Potri.002G101200 46 / 5e-06 AT1G72230 129 / 2e-37 Cupredoxin superfamily protein (.1)
Potri.001G332200 45 / 6e-06 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1)
Potri.009G136200 44 / 1e-05 AT5G26330 88 / 4e-22 Cupredoxin superfamily protein (.1)
Potri.016G015200 44 / 1e-05 AT3G27200 73 / 1e-16 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10037998 pacid=23163771 polypeptide=Lus10037998 locus=Lus10037998.g ID=Lus10037998.BGIv1.0 annot-version=v1.0
ATGAAATCCGCCGCGATCCTTCAGATCGCGATCGCCGCTGCTTTCCTGATCGCATCCGCGGCGTCCCAGCCTCCTCTTCCAACAGGCTACAAGAACCACA
CCGTCGGGGAGGATGCCGGCTGGTTCTTCAACTCCGCCACCAACACTCCCTCCGCCAACTACTCGTCTTGGGCATCCTCTCAGACCTTCAATTTGGGAGA
CTCCCTCATATTCCCGACGAATTCGAACCAGACACTTATCCAGACCTTCAACGATTCCACATTCCGGAGCTGCTCGGTCGACAATTCTTCAGACGACGAT
ACTTTCCAGTACTTGGGAGGGGCGCAGAACTACGGCGAGGCTTTGACCGTGGTGGTGCCGTTGACAATCGAAGGCCCCAACTACTACTTCTCCGATGCCA
ACGACGGCGTCCAGTGCCAGAATGGACTGGAATTCGAGACCCAAGCTAACCGAGGGCTCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCAATTCCAAGAGCCTCATAATGTATCG
GTGCACCTCATTATTGATTTTCGTAACTAA
AA sequence
>Lus10037998 pacid=23163771 polypeptide=Lus10037998 locus=Lus10037998.g ID=Lus10037998.BGIv1.0 annot-version=v1.0
MKSAAILQIAIAAAFLIASAASQPPLPTGYKNHTVGEDAGWFFNSATNTPSANYSSWASSQTFNLGDSLIFPTNSNQTLIQTFNDSTFRSCSVDNSSDDD
TFQYLGGAQNYGEALTVVVPLTIEGPNYYFSDANDGVQCQNGLEFETQANRGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQFQEPHNVS
VHLIIDFRN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G08500 AtENODL18 early nodulin-like protein 18 ... Lus10037998 0 1
AT5G45750 AtRABA1c RAB GTPase homolog A1C (.1) Lus10029253 1.7 0.8764
AT2G35470 unknown protein Lus10035375 5.8 0.7759
AT5G48660 B-cell receptor-associated pro... Lus10022777 7.0 0.8065
AT3G54250 GHMP kinase family protein (.1... Lus10043438 7.3 0.8208
AT1G06850 bZIP ATBZIP52 basic leucine-zipper 52 (.1.2) Lus10024204 8.1 0.8189
AT4G24330 Protein of unknown function (D... Lus10019958 9.0 0.7972
AT5G45750 AtRABA1c RAB GTPase homolog A1C (.1) Lus10007306 15.3 0.7836
AT5G36230 ARM repeat superfamily protein... Lus10029666 17.5 0.7662
AT3G61610 Galactose mutarotase-like supe... Lus10010131 17.9 0.7718
AT1G62981 Protein of unknown function (D... Lus10024481 19.1 0.8068

Lus10037998 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.