Lus10038607 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G11590 153 / 9e-47 AP2_ERF DREB3, TINY2 TINY2, Integrase-type DNA-binding superfamily protein (.1)
AT5G25810 139 / 1e-41 AP2_ERF TNY, TINY TINY, Integrase-type DNA-binding superfamily protein (.1)
AT4G32800 134 / 1e-39 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT2G25820 124 / 1e-35 AP2_ERF ESE2 ethylene and salt inducible 2, Integrase-type DNA-binding superfamily protein (.1)
AT3G60490 124 / 4e-35 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT4G16750 119 / 2e-34 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT2G44940 122 / 3e-34 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT3G16280 120 / 4e-34 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT2G35700 115 / 1e-32 AP2_ERF ATERF38 ERF family protein 38 (.1)
AT1G77200 113 / 4e-31 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002801 147 / 2e-44 AT5G11590 209 / 4e-68 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Lus10043240 130 / 9e-38 AT5G11590 176 / 1e-54 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Lus10034949 130 / 6e-37 AT4G32800 169 / 3e-51 Integrase-type DNA-binding superfamily protein (.1)
Lus10011123 121 / 3e-35 AT5G11590 143 / 6e-43 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Lus10004738 118 / 2e-33 AT2G35700 144 / 7e-44 ERF family protein 38 (.1)
Lus10007799 115 / 2e-33 AT2G44940 136 / 7e-42 Integrase-type DNA-binding superfamily protein (.1)
Lus10038270 115 / 2e-32 AT5G11590 168 / 4e-52 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Lus10025834 113 / 2e-31 AT5G11590 164 / 2e-50 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Lus10001601 111 / 8e-31 AT5G11590 159 / 1e-48 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G043900 145 / 8e-44 AT5G11590 212 / 5e-69 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Potri.001G187500 140 / 6e-42 AT5G25810 157 / 9e-48 TINY, Integrase-type DNA-binding superfamily protein (.1)
Potri.003G050700 139 / 3e-41 AT5G11590 166 / 5e-51 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Potri.006G238600 131 / 4e-38 AT5G11590 199 / 8e-64 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Potri.002G141200 127 / 2e-36 AT2G44940 158 / 6e-47 Integrase-type DNA-binding superfamily protein (.1)
Potri.001G155700 125 / 5e-36 AT2G44940 159 / 1e-47 Integrase-type DNA-binding superfamily protein (.1)
Potri.018G085700 126 / 8e-36 AT4G32800 155 / 4e-46 Integrase-type DNA-binding superfamily protein (.1)
Potri.014G055700 125 / 1e-35 AT2G44940 206 / 2e-65 Integrase-type DNA-binding superfamily protein (.1)
Potri.006G163400 124 / 4e-35 AT4G32800 159 / 6e-48 Integrase-type DNA-binding superfamily protein (.1)
Potri.003G079300 122 / 5e-35 AT4G16750 150 / 7e-46 Integrase-type DNA-binding superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Lus10038607 pacid=23143006 polypeptide=Lus10038607 locus=Lus10038607.g ID=Lus10038607.BGIv1.0 annot-version=v1.0
ATGAAAGCGAAGAAGGTGTACAGGGGAGTGAGAATGAGGAGTTGGGGGAAATGGGTATCGGAGATAAGGGAGCCCCGCAAGAAATCCCGCATTTGGCTCG
GCACTTACCCGACCCCTGAGATGGCAGCTCGCGCTCACGACGTTGCAGCTTTAACCCTCAAAAAGGGTAATTACTCCTCAATCCTCAATTTCCCAGAGAT
GGCACATTCCCTGCCCCGTCCCCTTTCTCTGGCACCTCGCCACGTTCAAGCCGCAGCAGCAAAGGCCGCCCACATGGACATGACTACTACTACTTCTGGC
CCCACCACCGCCATTAATCTTGCGCCTTCTTCCTTGTCGTCGTCTTCTGCGGATCATGAAGAGGAGGGATTGCTGAGCGAGATTGTGGAGCTCCCCTGTT
TGGGTGATGTCCGGGATGATCAGAAGAACAATGAGTTGGTGTTGGTTGACTCCTCGGCGGAAGGGTGGTTGCTGTACCCGCCGCCGTGGGATGATGATGA
TGATGAATTTGGGGGGGATATTGTACCCTTTTGGGAGAAATGA
AA sequence
>Lus10038607 pacid=23143006 polypeptide=Lus10038607 locus=Lus10038607.g ID=Lus10038607.BGIv1.0 annot-version=v1.0
MKAKKVYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTPEMAARAHDVAALTLKKGNYSSILNFPEMAHSLPRPLSLAPRHVQAAAAKAAHMDMTTTTSG
PTTAINLAPSSLSSSSADHEEEGLLSEIVELPCLGDVRDDQKNNELVLVDSSAEGWLLYPPPWDDDDDEFGGDIVPFWEK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G11590 AP2_ERF DREB3, TINY2 TINY2, Integrase-type DNA-bind... Lus10038607 0 1
AT5G27690 Heavy metal transport/detoxifi... Lus10031495 6.7 0.8573
AT4G37810 unknown protein Lus10019254 7.3 0.8795
AT2G46660 CYP78A6 "cytochrome P450, family 78, s... Lus10001670 8.1 0.8236
AT4G28100 unknown protein Lus10018524 9.5 0.8498
AT1G69560 MYB LOF2, ATMYB105 LATERAL ORGAN FUSION 2, myb do... Lus10026611 10.2 0.8598
AT1G69560 MYB LOF2, ATMYB105 LATERAL ORGAN FUSION 2, myb do... Lus10030452 18.4 0.8658
AT5G38760 Late embryogenesis abundant pr... Lus10026292 19.8 0.8626
AT2G30620 winged-helix DNA-binding trans... Lus10005534 21.5 0.8070
AT5G05830 RING/FYVE/PHD zinc finger supe... Lus10016451 23.0 0.7918
AT4G10810 unknown protein Lus10010114 23.2 0.8391

Lus10038607 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.