Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G06060 98 / 2e-25 TSC10A TSC10A, NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G19200 88 / 1e-21 TSC10B TSC10B, NAD(P)-binding Rossmann-fold superfamily protein (.1) AT4G09750 44 / 1e-05 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT2G29370 38 / 0.0008 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010510 [exp] 80 / 9e-20 AT5G19200 192 / 2e-61 TSC10B, NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10031170 [exp] 42 / 3e-05 AT3G12800 454 / 8e-163 short-chain dehydrogenase-reductase B (.1) Lus10031746 [exp] 40 / 0.0002 AT3G12800 463 / 4e-166 short-chain dehydrogenase-reductase B (.1) Lus10013594 [exp] 39 / 0.0004 AT3G51680 114 / 2e-31 short-chain dehydrogenase/reductase 2, NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10021258 [exp] 39 / 0.0006 AT2G47140 177 / 2e-54 short-chain dehydrogenase reductase 5, NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10024146 [exp] 0 / 1 AT3G06060 450 / 6e-160 TSC10A, NAD(P)-binding Rossmann-fold superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G191800 [exp] 95 / 4e-24 AT3G06060 448 / 2e-159 TSC10A, NAD(P)-binding Rossmann-fold superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF00106 [flax] [poplar] adh_short short chain dehydrogenase
Representative CDS sequence Show only first row Show all	>Lus10039502 pacid=23165317 polypeptide=Lus10039502 locus=Lus10039502.g ID=Lus10039502.BGIv1.0 annot-version=v1.0 ATGGCGGATTTCAATCTCGCTTACCTATCTCTACTCATCCTTCCTCTATTTCTCATTTTCCTTCTATCCTTCATAGTAAGGCCCCGCCCCGTCAAAATCA CACTCAAGAACCGCCATGTACTAATCACCGGTGGATCCAGCGGCATCGGTCTAGCCATGGCCCACCATGCCGCCAAGGAAGGTGCCCGCGTCTCCATCCT GGCACGATCCCTCGCTAAGCTCGAAGAAGCTAGGGCTTCCATTAAGCTCTCTACCGGCATCGAAGTCGCTGTATTTGCCGCGGATGTGAGGGATTTTGAC GCCGGCGGCGGAGCCAATCGACGTTTTGGTAGTGAATCAGGGAGTATTTTCCGCGGAGGAGCTGGAGAAGCAGTCGTTGGACGAAGTTAG
AA sequence Show only first row Show all	>Lus10039502 pacid=23165317 polypeptide=Lus10039502 locus=Lus10039502.g ID=Lus10039502.BGIv1.0 annot-version=v1.0 MADFNLAYLSLLILPLFLIFLLSFIVRPRPVKITLKNRHVLITGGSSGIGLAMAHHAAKEGARVSILARSLAKLEEARASIKLSTGIEVAVFAADVRDFD AGGGANRRFGSESGSIFRGGAGEAVVGRS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G06060		TSC10A	TSC10A, NAD(P)-binding Rossman...		Lus10039502 [exp]	0	1
AT3G06060		TSC10A	TSC10A, NAD(P)-binding Rossman...		Lus10039501 [exp]	1.0	0.9930
AT1G71050		HIPP20	heavy metal associated isopren...		Lus10042946 [exp]	4.2	0.9502
AT2G39080		EMB2799	EMBRYO DEFECTIVE 2799, NAD(P)-...		Lus10037911 [exp]	4.2	0.9620
					Lus10009632 [exp]	5.2	0.9616
					Lus10015218 [exp]	6.0	0.9380
AT3G53180		NodGS	nodulin/glutamine synthase-lik...		Lus10023904 [exp]	6.0	0.9611
AT5G28210			mRNA capping enzyme family pro...		Lus10040496 [exp]	6.3	0.9453
AT3G01680		SEOR1, SEOb	Sieve-Element-Occlusion-Relate...		Lus10000546 [exp]	6.7	0.9083
AT4G11530		CRK34	cysteine-rich RLK (RECEPTOR-li...		Lus10022285 [exp]	6.7	0.9611
					Lus10033730 [exp]	7.1	0.8862

Compare expression of checked genes

Lus10039502 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.