Lus10040710 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G11320 143 / 1e-42 Nucleotide-sugar transporter family protein (.1)
AT5G05820 139 / 2e-41 Nucleotide-sugar transporter family protein (.1)
AT1G12500 115 / 2e-31 Nucleotide-sugar transporter family protein (.1)
AT5G04160 104 / 6e-28 Nucleotide-sugar transporter family protein (.1)
AT3G10290 104 / 2e-27 Nucleotide-sugar transporter family protein (.1)
AT1G21870 56 / 6e-10 GONST5 golgi nucleotide sugar transporter 5 (.1)
AT1G77610 54 / 2e-09 EamA-like transporter family protein (.1)
AT5G25400 47 / 7e-07 Nucleotide-sugar transporter family protein (.1)
AT1G06890 47 / 1e-06 nodulin MtN21 /EamA-like transporter family protein (.1.2.3)
AT2G30460 46 / 2e-06 Nucleotide/sugar transporter family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016446 168 / 2e-52 AT5G05820 508 / 0.0 Nucleotide-sugar transporter family protein (.1)
Lus10040234 139 / 4e-41 AT3G11320 527 / 0.0 Nucleotide-sugar transporter family protein (.1)
Lus10028255 135 / 1e-39 AT3G11320 523 / 0.0 Nucleotide-sugar transporter family protein (.1)
Lus10009878 134 / 2e-39 AT3G11320 548 / 0.0 Nucleotide-sugar transporter family protein (.1)
Lus10014832 134 / 7e-39 AT3G11320 530 / 0.0 Nucleotide-sugar transporter family protein (.1)
Lus10042039 112 / 9e-31 AT3G10290 526 / 0.0 Nucleotide-sugar transporter family protein (.1)
Lus10018043 112 / 2e-30 AT3G10290 528 / 0.0 Nucleotide-sugar transporter family protein (.1)
Lus10006684 105 / 2e-28 AT1G12500 439 / 2e-156 Nucleotide-sugar transporter family protein (.1)
Lus10007029 103 / 2e-27 AT1G12500 457 / 2e-162 Nucleotide-sugar transporter family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G040800 149 / 4e-45 AT5G05820 472 / 2e-169 Nucleotide-sugar transporter family protein (.1)
Potri.008G063400 147 / 2e-44 AT3G11320 566 / 0.0 Nucleotide-sugar transporter family protein (.1)
Potri.010G194100 147 / 3e-44 AT3G11320 572 / 0.0 Nucleotide-sugar transporter family protein (.1)
Potri.001G247600 143 / 1e-42 AT3G11320 476 / 4e-171 Nucleotide-sugar transporter family protein (.1)
Potri.003G118000 117 / 2e-32 AT1G12500 503 / 4e-180 Nucleotide-sugar transporter family protein (.1)
Potri.016G043200 106 / 1e-28 AT5G04160 512 / 0.0 Nucleotide-sugar transporter family protein (.1)
Potri.006G046600 105 / 2e-28 AT5G04160 503 / 0.0 Nucleotide-sugar transporter family protein (.1)
Potri.001G114100 106 / 3e-28 AT1G12500 483 / 8e-172 Nucleotide-sugar transporter family protein (.1)
Potri.005G177200 52 / 2e-08 AT1G77610 561 / 0.0 EamA-like transporter family protein (.1)
Potri.001G394500 50 / 9e-08 AT3G14410 496 / 5e-178 Nucleotide/sugar transporter family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0184 DMT PF03151 TPT Triose-phosphate Transporter family
Representative CDS sequence
>Lus10040710 pacid=23157777 polypeptide=Lus10040710 locus=Lus10040710.g ID=Lus10040710.BGIv1.0 annot-version=v1.0
ATGGCTCGCCAAGCTAGACACGAGCTAACACTTTCTACCTCGAGCACAGGAGAAGCTCCATTCGATGAACCTGCTGATGTACATGGCACCAGTAGCTGTC
GCTTTCCTTCTACCGACGGCTGTGATAATGGAAACAAACGTCATCGGAATCACAATAGCACAAGCAAAGACGACAAGAGGTTCATATTTTACCTGCTCTT
CAATGCTTCCCTTTCCTATCTGGTAAACTTGACCAACTTCCTCGTCACCAAGCACACCAGCGCCTCGACTCTCCAGGTGCTGGGGAATGCAAAGGGTGCA
GTGGCGGTAGTACTGTCGATTCTGATATTCAGGAATCCGGTGTCGGTGACCGGAATGTTGGGATACGGTGTGACTGTGTTTGGTGTCATCCTATACAACG
AGGCCAAGAAAAGAGCCAAGTCATGA
AA sequence
>Lus10040710 pacid=23157777 polypeptide=Lus10040710 locus=Lus10040710.g ID=Lus10040710.BGIv1.0 annot-version=v1.0
MARQARHELTLSTSSTGEAPFDEPADVHGTSSCRFPSTDGCDNGNKRHRNHNSTSKDDKRFIFYLLFNASLSYLVNLTNFLVTKHTSASTLQVLGNAKGA
VAVVLSILIFRNPVSVTGMLGYGVTVFGVILYNEAKKRAKS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G11320 Nucleotide-sugar transporter f... Lus10040710 0 1
AT5G26250 Major facilitator superfamily ... Lus10010532 2.4 0.7239
AT5G55840 Pentatricopeptide repeat (PPR)... Lus10038697 15.1 0.6776
AT2G30480 unknown protein Lus10019109 69.9 0.6425
AT5G59530 2-oxoglutarate (2OG) and Fe(II... Lus10041230 118.6 0.6437
AT3G23600 alpha/beta-Hydrolases superfam... Lus10000665 139.1 0.6200

Lus10040710 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.