Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G25190 173 / 3e-55 AP2_ERF ESE3 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) AT5G25390 92 / 1e-23 AP2_ERF SHN3, SHN2 shine3, Integrase-type DNA-binding superfamily protein (.1.2) AT5G11190 89 / 4e-22 AP2_ERF SHN2, SHN3 shine2, Integrase-type DNA-binding superfamily protein (.1) AT1G15360 89 / 6e-22 AP2_ERF WIN1, SHN1 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) AT5G65130 76 / 2e-16 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G13620 72 / 5e-15 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G36060 71 / 1e-14 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G22190 71 / 1e-14 AP2_ERF RAP2.4 related to AP2 4, Integrase-type DNA-binding superfamily protein (.1) AT1G28370 69 / 1e-14 AP2_ERF AtERF11 ERF domain protein 11 (.1) AT1G71450 69 / 2e-14 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005343 [exp] 198 / 2e-65 AT5G25190 174 / 3e-56 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10016815 [exp] 169 / 2e-53 AT5G25190 206 / 1e-68 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10035859 [exp] 162 / 9e-51 AT5G25190 196 / 9e-65 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10041614 [exp] 101 / 2e-26 AT5G25190 165 / 1e-51 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10009480 [exp] 99 / 6e-26 AT1G15360 207 / 1e-68 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10002015 [exp] 96 / 9e-25 AT1G15360 183 / 4e-59 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10005716 [exp] 95 / 4e-24 AT1G15360 236 / 3e-79 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10030097 [exp] 94 / 1e-23 AT1G15360 234 / 1e-78 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10019414 [exp] 91 / 2e-22 AT1G15360 207 / 1e-67 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G021900 [exp] 198 / 6e-65 AT5G25190 169 / 1e-53 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.006G261200 [exp] 192 / 1e-62 AT5G25190 169 / 9e-54 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.001G048200 [exp] 167 / 4e-53 AT5G25190 162 / 5e-51 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.003G179900 [exp] 103 / 1e-27 AT5G25190 100 / 1e-26 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.018G028000 [exp] 95 / 2e-24 AT5G11190 204 / 8e-68 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.006G069400 [exp] 91 / 1e-22 AT1G15360 186 / 9e-60 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.018G131400 [exp] 91 / 1e-22 AT1G15360 194 / 6e-63 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.006G253800 [exp] 91 / 1e-22 AT5G11190 197 / 1e-64 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.003G033000 [exp] 85 / 8e-21 AT1G15360 181 / 3e-58 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.017G055400 [exp] 74 / 2e-15 AT4G13620 216 / 9e-66 Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10041023 pacid=23179779 polypeptide=Lus10041023 locus=Lus10041023.g ID=Lus10041023.BGIv1.0 annot-version=v1.0 ATGACGAGACCACAACAAAGATACCGAGGCGTTCGACAACGCCAGTGGGGCTCCTGGGTCTCCGAAATCCGCCACCCATTATTGAAGACGAGGATTTGGT TAGGAACATTCGAGACGGCGGAGGACGCGGCTCGAGCCTACGACGAGGCGGCTCGGCTGATGTGCGGGCAAAGGGCAAGGACCAATTTCCCTTACAACCC AAGTGCCCATCAATCCGCTTCCTCTAAGCTCCTCTCCGCAAATCTCGTTGCCAAACTTCAAAAGTGCTACATGGCTTCTTTGCAAATGGCCGAACAAGCT TCCTTTCAGCAACAGCAGCAGCAATTTGAGAAATCCACAGCTGTCCATGTGGTCAATAATGCAGTGAAAACAGAGGAATTAGGGACGTACAACGACAGTA GTTACTCGCGGCCGCCGCCGCAGAAGAAAAGGGCAGTGCTAGTGCAACAACAAGTTGAAGAGGCAGAGTCGAACACGGTGAAGAAAGTTCAAGTGGAGAG CAGAGAGCAGTTGGAAGAGCATCACATTGAGCAAATGATAGAAGAGTTGCTTCATTACGGCACCATTGAGCTCTGTCCTTCTGTTTAA
AA sequence Show only first row Show all	>Lus10041023 pacid=23179779 polypeptide=Lus10041023 locus=Lus10041023.g ID=Lus10041023.BGIv1.0 annot-version=v1.0 MTRPQQRYRGVRQRQWGSWVSEIRHPLLKTRIWLGTFETAEDAARAYDEAARLMCGQRARTNFPYNPSAHQSASSKLLSANLVAKLQKCYMASLQMAEQA SFQQQQQQFEKSTAVHVVNNAVKTEELGTYNDSSYSRPPPQKKRAVLVQQQVEEAESNTVKKVQVESREQLEEHHIEQMIEELLHYGTIELCPSV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G25190	AP2_ERF	ESE3	ethylene and salt inducible 3,...		Lus10041023 [exp]	0	1
AT2G26110			Protein of unknown function (D...		Lus10024988 [exp]	4.6	0.8664
AT2G34700			Pollen Ole e 1 allergen and ex...		Lus10014013 [exp]	8.1	0.8787
AT2G01610			Plant invertase/pectin methyle...		Lus10038645 [exp]	8.1	0.8839
AT2G20760			Clathrin light chain protein (...		Lus10011194 [exp]	16.4	0.8745
AT1G46480	HD	WOX4	WUSCHEL related homeobox 4 (.1...		Lus10024808 [exp]	19.3	0.8714
AT2G38360		PRA1.B4	prenylated RAB acceptor 1.B4 (...		Lus10017425 [exp]	27.4	0.8562
					Lus10040587 [exp]	28.0	0.8661
AT3G45230			hydroxyproline-rich glycoprote...		Lus10041306 [exp]	29.8	0.8632
AT3G49750		AtRLP44	receptor like protein 44 (.1)		Lus10011561 [exp]	30.5	0.8695
AT5G11730			Core-2/I-branching beta-1,6-N-...		Lus10005504 [exp]	31.5	0.8529

Compare expression of checked genes

Lus10041023 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.