Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G71520 132 / 2e-40 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G22810 124 / 4e-37 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G74930 98 / 5e-26 AP2_ERF ORA47, ERF018 Integrase-type DNA-binding superfamily protein (.1) AT4G06746 88 / 7e-23 AP2_ERF DEAR5, RAP2.9 DREB AND EAR MOTIF PROTEIN 5, related to AP2 9 (.1) AT1G19210 86 / 2e-21 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G21960 86 / 3e-21 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT3G50260 84 / 4e-21 AP2_ERF DEAR1, CEJ1, ATERF#011 DREB AND EAR MOTIF PROTEIN 1, cooperatively regulated by ethylene and jasmonate 1 (.1) AT1G21910 85 / 1e-20 AP2_ERF DREB26 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1) AT5G67190 81 / 2e-19 AP2_ERF DEAR2 DREB and EAR motif protein 2 (.1) AT2G23340 80 / 3e-19 AP2_ERF DEAR3 DREB and EAR motif protein 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006179 [exp] 164 / 7e-53 AT1G71520 123 / 7e-37 Integrase-type DNA-binding superfamily protein (.1) Lus10009468 [exp] 150 / 2e-47 AT1G22810 132 / 1e-40 Integrase-type DNA-binding superfamily protein (.1) Lus10038082 [exp] 88 / 8e-22 AT5G21960 155 / 3e-47 Integrase-type DNA-binding superfamily protein (.1) Lus10033420 [exp] 84 / 1e-20 AT1G19210 181 / 4e-58 Integrase-type DNA-binding superfamily protein (.1) Lus10009798 [exp] 82 / 3e-20 AT1G19210 132 / 1e-39 Integrase-type DNA-binding superfamily protein (.1) Lus10034885 [exp] 81 / 3e-19 AT1G19210 172 / 2e-54 Integrase-type DNA-binding superfamily protein (.1) Lus10009373 [exp] 79 / 3e-19 AT5G67190 164 / 3e-52 DREB and EAR motif protein 2 (.1) Lus10018727 [exp] 79 / 6e-19 AT5G67190 162 / 1e-51 DREB and EAR motif protein 2 (.1) Lus10010043 [exp] 77 / 2e-18 AT2G23340 170 / 1e-54 DREB and EAR motif protein 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G100300 [exp] 149 / 1e-46 AT1G22810 140 / 5e-43 Integrase-type DNA-binding superfamily protein (.1) Potri.019G073300 [exp] 146 / 4e-45 AT1G22810 144 / 1e-44 Integrase-type DNA-binding superfamily protein (.1) Potri.006G218200 [exp] 91 / 2e-23 AT1G19210 176 / 4e-56 Integrase-type DNA-binding superfamily protein (.1) Potri.006G138700 [exp] 86 / 3e-21 AT1G19210 174 / 1e-55 Integrase-type DNA-binding superfamily protein (.1) Potri.018G047300 [exp] 86 / 3e-21 AT1G19210 169 / 1e-53 Integrase-type DNA-binding superfamily protein (.1) Potri.006G138800 [exp] 85 / 7e-21 AT1G19210 189 / 3e-61 Integrase-type DNA-binding superfamily protein (.1) Potri.018G038100 [exp] 81 / 9e-20 AT5G21960 100 / 5e-27 Integrase-type DNA-binding superfamily protein (.1) Potri.014G025200 [exp] 78 / 1e-18 AT1G46768 160 / 3e-51 related to AP2 1 (.1) Potri.002G085600 [exp] 78 / 2e-18 AT1G77640 127 / 3e-36 Integrase-type DNA-binding superfamily protein (.1) Potri.005G176000 [exp] 78 / 3e-18 AT1G21910 140 / 3e-41 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10041044 pacid=23179936 polypeptide=Lus10041044 locus=Lus10041044.g ID=Lus10041044.BGIv1.0 annot-version=v1.0 ATGAGCAACAGCGCCGGAGAGAAGAAGTACAAAGGAGTCCGCCGCCGGAAATGGGGGAAATGGGTGTCAGAAATCCGGGTCCCCGGATCCCAGGACCGCC TCTGGCTCGGGTCTTACTCTTCCTCTGAAGCTGCCGCCGTCGCCCACGACATTGCTTACTATTGCCTCCGGCGGGGCGATTCGTCTTCGTCGGCGGGGAA GAGCTACAATTTCCCACTGGCGTCATTGCCGACGAGCGTGCTCCAGCCTGATTTGTCGCCGAAGTCCGTCCAGAGAGCGGCTTCCGATGCCGGAATGGCG GTGGACGCGCAGTTGATACTCCAGAATTCGACATCGACAGCTTCGGGTGGAAGTGGTGGTTCAGAGATGTGGCCGGAGACGTCCTGGGGTGGAGAAGATC ACGGCAGTGGGAGTTGGGGAGAGGATGTTCTCGACTTGTCTGTTGAAGATTATTTGTGA
AA sequence Show only first row Show all	>Lus10041044 pacid=23179936 polypeptide=Lus10041044 locus=Lus10041044.g ID=Lus10041044.BGIv1.0 annot-version=v1.0 MSNSAGEKKYKGVRRRKWGKWVSEIRVPGSQDRLWLGSYSSSEAAAVAHDIAYYCLRRGDSSSSAGKSYNFPLASLPTSVLQPDLSPKSVQRAASDAGMA VDAQLILQNSTSTASGGSGGSEMWPETSWGGEDHGSGSWGEDVLDLSVEDYL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G71520	AP2_ERF		Integrase-type DNA-binding sup...		Lus10041044 [exp]	0	1
AT3G22880		ARLIM15, ATDMC1	ARABIDOPSIS THALIANA DISRUPTIO...		Lus10039383 [exp]	1.4	0.9829
AT1G47670			Transmembrane amino acid trans...		Lus10022641 [exp]	2.6	0.9859
AT4G08250	GRAS		GRAS family transcription fact...		Lus10008316 [exp]	3.0	0.9801
AT1G02030	C2H2ZnF		C2H2-like zinc finger protein ...		Lus10027220 [exp]	4.2	0.9754
					Lus10021010 [exp]	4.9	0.9730
AT5G05600			2-oxoglutarate (2OG) and Fe(II...		Lus10004808 [exp]	5.7	0.9797
AT1G14040			EXS (ERD1/XPR1/SYG1) family pr...		Lus10030439 [exp]	8.4	0.9709
AT3G12500		PR-3, PR3, CHI-...	PATHOGENESIS-RELATED 3, basic ...		Lus10028377 [exp]	19.1	0.9781
AT4G37290			unknown protein		Lus10019310 [exp]	21.4	0.9780
AT3G26770			NAD(P)-binding Rossmann-fold s...		Lus10021313 [exp]	22.1	0.9759

Compare expression of checked genes

Lus10041044 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.