Lus10041211 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26330 164 / 1e-51 Cupredoxin superfamily protein (.1)
AT2G26720 119 / 6e-34 Cupredoxin superfamily protein (.1)
AT2G31050 116 / 7e-33 Cupredoxin superfamily protein (.1)
AT2G32300 98 / 4e-25 UCC1 uclacyanin 1 (.1)
AT3G17675 88 / 6e-23 Cupredoxin superfamily protein (.1)
AT3G27200 84 / 2e-20 Cupredoxin superfamily protein (.1)
AT5G07475 81 / 2e-19 Cupredoxin superfamily protein (.1)
AT2G02850 79 / 3e-19 ARPN plantacyanin (.1)
AT3G60270 80 / 1e-18 Cupredoxin superfamily protein (.1)
AT4G30590 79 / 3e-18 AtENODL12 early nodulin-like protein 12 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021925 263 / 1e-90 AT5G26330 170 / 5e-54 Cupredoxin superfamily protein (.1)
Lus10010533 217 / 2e-72 AT5G26330 174 / 1e-55 Cupredoxin superfamily protein (.1)
Lus10002451 181 / 5e-58 AT5G26330 136 / 2e-40 Cupredoxin superfamily protein (.1)
Lus10027143 96 / 1e-24 AT2G32300 137 / 9e-40 uclacyanin 1 (.1)
Lus10006657 96 / 9e-24 AT1G45063 106 / 1e-26 copper ion binding;electron carriers (.1.2)
Lus10038098 96 / 1e-23 AT1G45063 107 / 1e-27 copper ion binding;electron carriers (.1.2)
Lus10041570 92 / 1e-23 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1)
Lus10002615 87 / 5e-22 AT5G26330 96 / 9e-26 Cupredoxin superfamily protein (.1)
Lus10025752 88 / 1e-21 AT5G20230 101 / 1e-26 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G089900 184 / 1e-59 AT5G26330 187 / 7e-61 Cupredoxin superfamily protein (.1)
Potri.008G151000 177 / 1e-56 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1)
Potri.002G161300 130 / 1e-38 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
Potri.006G259101 129 / 3e-38 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1)
Potri.006G259000 129 / 5e-38 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1)
Potri.001G268700 125 / 7e-37 AT5G26330 138 / 6e-42 Cupredoxin superfamily protein (.1)
Potri.002G156401 124 / 2e-36 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1)
Potri.002G156100 124 / 2e-36 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1)
Potri.002G052500 117 / 1e-33 AT5G26330 130 / 9e-39 Cupredoxin superfamily protein (.1)
Potri.003G047300 116 / 2e-32 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10041211 pacid=23179920 polypeptide=Lus10041211 locus=Lus10041211.g ID=Lus10041211.BGIv1.0 annot-version=v1.0
ATGGGTATGGCTCACAAAGCTTCTGGCTTTGCACAGCTAGTGTCAATGGCGGTGCTGCTGCACCTGGTAATCCAATCAAATGGAGCTTTTCACAAGGTTG
GAGACTCAGTGGGTTGGACTATAATGGGGAGTCCCGATTACAAACAGTGGGCTTCCACCAAGTCCTTCCAACTTGGCGACATTGTTCATTTCGAGTACAA
CCCACAGTTCCACAACGTGATGAAGGTAACCCACGCCATGTACAGAGCCTGCAACGCTTCAGCTCCACTAGAAACATACACTACAGGAAACGATTCCATC
TCCATAACAACCCGCGGCCACCACTACTTCATCTGCGGCGTCGTCGGCCATTGCCAGTCCGGCCAGAAGGTCGACATCAACGTCCTCCGCACTGATCCTT
CTTCTTCGTCGCCACCCCCCGCCGGTGCTGCAGTGGCAGTCTCCCCCACACTTCCTTCCGCACAATCCCCTGCGCCTTCTGCAAATTCAGCCTCTTCCTT
CATCACTCCCATGGCTCTTCTCCTCGCTGCCGGCGCAATCCTCTCCCATCTCGGATTCGCTTAA
AA sequence
>Lus10041211 pacid=23179920 polypeptide=Lus10041211 locus=Lus10041211.g ID=Lus10041211.BGIv1.0 annot-version=v1.0
MGMAHKASGFAQLVSMAVLLHLVIQSNGAFHKVGDSVGWTIMGSPDYKQWASTKSFQLGDIVHFEYNPQFHNVMKVTHAMYRACNASAPLETYTTGNDSI
SITTRGHHYFICGVVGHCQSGQKVDINVLRTDPSSSSPPPAGAAVAVSPTLPSAQSPAPSANSASSFITPMALLLAAGAILSHLGFA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G26330 Cupredoxin superfamily protein... Lus10041211 0 1
AT5G14940 Major facilitator superfamily ... Lus10032177 1.0 0.9772
AT1G17620 Late embryogenesis abundant (L... Lus10037638 2.0 0.9667
AT1G24030 Protein kinase superfamily pro... Lus10010703 3.5 0.9651
AT2G37900 Major facilitator superfamily ... Lus10024340 5.5 0.9588
AT1G62710 BETAVPE, BETA-V... beta vacuolar processing enzym... Lus10032236 5.9 0.9603
AT3G16920 ATCTL2 chitinase-like protein 2 (.1) Lus10016872 8.2 0.9614
AT5G17600 RING/U-box superfamily protein... Lus10013618 9.9 0.9146
AT1G48780 unknown protein Lus10009633 12.1 0.9302
AT5G61840 GUT1, IRX10-L Exostosin family protein (.1) Lus10032530 14.8 0.9486
AT1G17620 Late embryogenesis abundant (L... Lus10015622 16.0 0.9518

Lus10041211 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.