Lus10041332 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G03340 280 / 4e-90 ATPase, AAA-type, CDC48 protein (.1)
AT3G09840 275 / 5e-88 ATCDC48, CDC48A, CDC48 cell division cycle 48 (.1)
AT3G53230 265 / 4e-84 ATPase, AAA-type, CDC48 protein (.1)
AT3G01610 106 / 1e-26 CDC48C, EMB1354 embryo defective 1354, cell division cycle 48C (.1)
AT3G56690 91 / 4e-21 CIP111 Cam interacting protein 111 (.1)
AT5G53170 84 / 5e-19 FTSH11 FTSH protease 11 (.1)
AT1G45000 82 / 3e-18 AAA-type ATPase family protein (.1.2)
AT5G43010 81 / 5e-18 RPT4A regulatory particle triple-A ATPase 4A (.1)
AT3G16290 81 / 8e-18 EMB2083 embryo defective 2083, AAA-type ATPase family protein (.1)
AT2G03670 79 / 3e-17 CDC48B cell division cycle 48B (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037385 335 / 4e-111 AT5G03340 1501 / 0.0 ATPase, AAA-type, CDC48 protein (.1)
Lus10021442 282 / 9e-91 AT5G03340 1520 / 0.0 ATPase, AAA-type, CDC48 protein (.1)
Lus10016123 272 / 5e-87 AT5G03340 1526 / 0.0 ATPase, AAA-type, CDC48 protein (.1)
Lus10023018 268 / 9e-86 AT5G03340 1419 / 0.0 ATPase, AAA-type, CDC48 protein (.1)
Lus10021441 266 / 1e-84 AT5G03340 1529 / 0.0 ATPase, AAA-type, CDC48 protein (.1)
Lus10016124 266 / 1e-84 AT5G03340 1511 / 0.0 ATPase, AAA-type, CDC48 protein (.1)
Lus10001403 103 / 6e-29 AT3G09840 114 / 6e-31 cell division cycle 48 (.1)
Lus10001402 96 / 4e-23 AT3G53230 803 / 0.0 ATPase, AAA-type, CDC48 protein (.1)
Lus10020255 90 / 7e-21 AT3G56690 1066 / 0.0 Cam interacting protein 111 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G125500 281 / 1e-90 AT5G03340 1496 / 0.0 ATPase, AAA-type, CDC48 protein (.1)
Potri.016G091600 281 / 2e-90 AT3G53230 1484 / 0.0 ATPase, AAA-type, CDC48 protein (.1)
Potri.015G080600 279 / 1e-89 AT5G03340 1455 / 0.0 ATPase, AAA-type, CDC48 protein (.1)
Potri.012G088200 270 / 5e-86 AT5G03340 1459 / 0.0 ATPase, AAA-type, CDC48 protein (.1)
Potri.017G108200 241 / 2e-75 AT5G03340 1311 / 0.0 ATPase, AAA-type, CDC48 protein (.1)
Potri.006G035000 92 / 8e-22 AT3G56690 1080 / 0.0 Cam interacting protein 111 (.1)
Potri.013G151600 89 / 2e-20 AT3G01610 747 / 0.0 embryo defective 1354, cell division cycle 48C (.1)
Potri.001G128700 87 / 6e-20 AT2G03670 766 / 0.0 cell division cycle 48B (.1)
Potri.012G000700 83 / 1e-18 AT5G53170 1076 / 0.0 FTSH protease 11 (.1)
Potri.003G050600 83 / 2e-18 AT3G16290 1159 / 0.0 embryo defective 2083, AAA-type ATPase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00004 AAA ATPase family associated with various cellular activities (AAA)
Representative CDS sequence
>Lus10041332 pacid=23179580 polypeptide=Lus10041332 locus=Lus10041332.g ID=Lus10041332.BGIv1.0 annot-version=v1.0
ATGGACGGCATGTCAGCAAAGAAGACCGATTTCATAATCGGAACCACAAACAGGCCCGACATCATCGATCCGGCACTCCTGAGGCCCGGCCGTCTTGACC
AGTTGATTTATATCCCTCTTCCGGATGAGGATTCGCGCCACAACATCTTCAAAGCCTGGTTAAGGAAATCGCCCGTGGCAAAGGATGTTGACTTGAGAGC
ATTGGCTAAATACACGCAAGGGTTCAGTGGCGCTGATATCACTGAGATATGCCAGCGGCCTTGCAAGTATGCCATAAGAGAGAACATAGAGACGGATATT
GAAAGGGAAAGGAGGAGGAGGGACACCCCGGAAGCGATGCAGGAGGACATGGACGACGAGGTTGCAGAGATCAAAGCTGCACATTTCGAAGAGTCGATGA
AGTATGCTCGAAGGAGTGTGAGTGACGCAGATATCCGCAAGTACCAGACGTTTGCTCAGACATTGCAGCAATCTAGGGGTGTAGGATCAGAGTTCAGGTT
TTTGGAATCTCGAACCGGGATGGCTGCTGCGGCCGATCCGTTCTCAACTTCGGCTGGTGGAGCTGATGAAGATGATTTGCATAGTTAG
AA sequence
>Lus10041332 pacid=23179580 polypeptide=Lus10041332 locus=Lus10041332.g ID=Lus10041332.BGIv1.0 annot-version=v1.0
MDGMSAKKTDFIIGTTNRPDIIDPALLRPGRLDQLIYIPLPDEDSRHNIFKAWLRKSPVAKDVDLRALAKYTQGFSGADITEICQRPCKYAIRENIETDI
ERERRRRDTPEAMQEDMDDEVAEIKAAHFEESMKYARRSVSDADIRKYQTFAQTLQQSRGVGSEFRFLESRTGMAAAADPFSTSAGGADEDDLHS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G03340 ATPase, AAA-type, CDC48 protei... Lus10041332 0 1
Lus10000351 3.9 1.0000
Lus10002886 5.5 1.0000
AT5G55050 GDSL-like Lipase/Acylhydrolase... Lus10021543 6.7 1.0000
Lus10014748 7.5 1.0000
AT3G26880 Plant self-incompatibility pro... Lus10022631 8.4 1.0000
AT3G25050 XTH3 xyloglucan endotransglucosylas... Lus10022782 9.2 1.0000
Lus10023108 9.9 1.0000
AT5G50790 SWEET10, AtSWEE... Nodulin MtN3 family protein (.... Lus10023249 11.0 1.0000
Lus10024321 11.2 1.0000
AT3G52470 Late embryogenesis abundant (L... Lus10027133 11.7 0.8202

Lus10041332 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.