Lus10041372 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G19790 75 / 5e-17 AP2_ERF RAP2.11 related to AP2 11 (.1)
AT4G11140 66 / 8e-14 AP2_ERF CRF1 cytokinin response factor 1 (.1)
AT4G23750 64 / 7e-13 AP2_ERF TMO3, CRF2 TARGET OF MONOPTEROS 3, cytokinin response factor 2 (.1.2)
AT5G18560 62 / 3e-12 AP2_ERF PUCHI Integrase-type DNA-binding superfamily protein (.1)
AT3G61630 61 / 1e-11 AP2_ERF CRF6 cytokinin response factor 6 (.1)
AT1G22190 60 / 2e-11 AP2_ERF RAP2.4 related to AP2 4, Integrase-type DNA-binding superfamily protein (.1)
AT1G43160 57 / 6e-11 AP2_ERF RAP2.6, RAP2.06 related to AP2 6 (.1)
AT5G53290 59 / 7e-11 AP2_ERF CRF3 cytokinin response factor 3 (.1)
AT5G65130 58 / 7e-11 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G50080 57 / 1e-10 AP2_ERF ERF110 ethylene response factor 110 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036556 141 / 4e-44 AT5G19790 104 / 2e-28 related to AP2 11 (.1)
Lus10008291 82 / 3e-19 AT5G19790 106 / 3e-26 related to AP2 11 (.1)
Lus10036793 80 / 4e-18 AT5G19790 115 / 4e-29 related to AP2 11 (.1)
Lus10037137 79 / 7e-18 AT5G19790 116 / 2e-29 related to AP2 11 (.1)
Lus10001298 74 / 1e-17 AT5G19790 118 / 1e-33 related to AP2 11 (.1)
Lus10012703 78 / 2e-17 AT5G19790 119 / 3e-31 related to AP2 11 (.1)
Lus10030430 77 / 4e-17 AT5G19790 115 / 1e-29 related to AP2 11 (.1)
Lus10013764 76 / 4e-17 AT5G19790 132 / 6e-37 related to AP2 11 (.1)
Lus10039171 75 / 1e-16 AT5G19790 133 / 3e-37 related to AP2 11 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G076702 93 / 2e-23 AT5G19790 74 / 5e-15 related to AP2 11 (.1)
Potri.002G153500 89 / 5e-22 AT5G19790 79 / 6e-17 related to AP2 11 (.1)
Potri.001G453100 78 / 9e-18 AT5G19790 71 / 5e-14 related to AP2 11 (.1)
Potri.008G091300 77 / 3e-17 AT5G19790 80 / 5e-17 related to AP2 11 (.1)
Potri.017G087800 74 / 2e-16 AT5G19790 89 / 3e-20 related to AP2 11 (.1)
Potri.003G220200 73 / 3e-16 AT5G19790 164 / 1e-49 related to AP2 11 (.1)
Potri.013G056700 71 / 1e-15 AT5G19790 105 / 4e-27 related to AP2 11 (.1)
Potri.011G148900 71 / 2e-15 AT5G19790 65 / 5e-12 related to AP2 11 (.1)
Potri.019G036100 69 / 7e-15 AT5G19790 98 / 3e-24 related to AP2 11 (.1)
Potri.001G004700 69 / 1e-14 AT5G19790 112 / 1e-29 related to AP2 11 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Lus10041372 pacid=23179944 polypeptide=Lus10041372 locus=Lus10041372.g ID=Lus10041372.BGIv1.0 annot-version=v1.0
ATGGCAGGAAACATTCCAGTGCAGGGCCAGATCAGCACCTCCACCGCTGTGAAACCCCGCCGGTTCGTCGGAGTTAGGCAGAGGCCTTCCGGGAGATGGG
TTGCCGAAATCAAAGACTCCTCCCAGCGTGTCAGGCTATGGCTTGGAACCTACGACACCCCTGAAGAAGCCGCCAGAGCTTATGACGAAGCTGCCCGCGC
CCTCCGCGGCGATAATGCTCGCACCAATTTCGCTTCCTCTTCCGATTCCAAGACCGCCGCAACCAACGCCCGCCGCGGGCGCCCTCCCCCTCCACACTCT
TGCGTCATCGTCCGCGTCAGCGTCTGCGTCCCTGGCGTCCCCGAATCCGAATCCTTTCTCGTCTCTGAAGGCGAAGCTGAGCAAGAATCTGCAGAGCATA
ATGGCAAGGACTAG
AA sequence
>Lus10041372 pacid=23179944 polypeptide=Lus10041372 locus=Lus10041372.g ID=Lus10041372.BGIv1.0 annot-version=v1.0
MAGNIPVQGQISTSTAVKPRRFVGVRQRPSGRWVAEIKDSSQRVRLWLGTYDTPEEAARAYDEAARALRGDNARTNFASSSDSKTAATNARRGRPPPPHS
CVIVRVSVCVPGVPESESFLVSEGEAEQESAEHNGKD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G19790 AP2_ERF RAP2.11 related to AP2 11 (.1) Lus10041372 0 1
Lus10041371 1.0 0.9304
AT4G02380 SAG21, ATLEA5 Arabidopsis thaliana late embr... Lus10029634 4.1 0.8543
AT3G17130 Plant invertase/pectin methyle... Lus10017074 6.8 0.8471
AT4G29680 Alkaline-phosphatase-like fami... Lus10032681 8.0 0.8945
AT5G40190 RNA ligase/cyclic nucleotide p... Lus10039477 8.1 0.8570
AT3G21360 2-oxoglutarate (2OG) and Fe(II... Lus10025819 10.4 0.8868
AT3G18490 Eukaryotic aspartyl protease f... Lus10032482 12.6 0.8663
AT1G70090 GATL9, LGT8 GALACTURONOSYLTRANSFERASE-LIKE... Lus10013296 13.1 0.8664
AT3G21890 CO B-box type zinc finger family ... Lus10031583 16.1 0.8631
AT3G18490 Eukaryotic aspartyl protease f... Lus10032481 16.5 0.8618

Lus10041372 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.