Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G25190 103 / 2e-27 AP2_ERF ESE3 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) AT1G15360 69 / 2e-14 AP2_ERF WIN1, SHN1 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) AT5G25390 67 / 1e-13 AP2_ERF SHN3, SHN2 shine3, Integrase-type DNA-binding superfamily protein (.1.2) AT5G11190 67 / 2e-13 AP2_ERF SHN2, SHN3 shine2, Integrase-type DNA-binding superfamily protein (.1) AT1G21910 54 / 8e-09 AP2_ERF DREB26 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1) AT3G20310 54 / 8e-09 AP2_ERF ATERF7, ATERF-7 ethylene response factor 7 (.1) AT5G05410 54 / 2e-08 AP2_ERF DREB2A DEHYDRATION-RESPONSIVE ELEMENT BINDING PROTEIN 2, DRE-binding protein 2A (.1.2) AT4G06746 52 / 3e-08 AP2_ERF DEAR5, RAP2.9 DREB AND EAR MOTIF PROTEIN 5, related to AP2 9 (.1) AT1G77640 52 / 4e-08 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G21960 52 / 6e-08 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041023 [exp] 99 / 1e-25 AT5G25190 205 / 7e-68 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10035859 [exp] 94 / 5e-24 AT5G25190 196 / 9e-65 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10016815 [exp] 93 / 1e-23 AT5G25190 206 / 1e-68 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10005343 [exp] 91 / 4e-23 AT5G25190 174 / 3e-56 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10005716 [exp] 82 / 9e-19 AT1G15360 236 / 3e-79 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10030097 [exp] 80 / 5e-18 AT1G15360 234 / 1e-78 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10009480 [exp] 69 / 2e-14 AT1G15360 207 / 1e-68 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10019414 [exp] 69 / 6e-14 AT1G15360 207 / 1e-67 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10002015 [exp] 66 / 2e-13 AT1G15360 183 / 4e-59 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G048200 [exp] 106 / 9e-29 AT5G25190 162 / 5e-51 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.006G261200 [exp] 104 / 8e-28 AT5G25190 169 / 9e-54 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.018G021900 [exp] 104 / 1e-27 AT5G25190 169 / 1e-53 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.003G179900 [exp] 71 / 4e-15 AT5G25190 100 / 1e-26 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.018G131400 [exp] 71 / 6e-15 AT1G15360 194 / 6e-63 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.003G033000 [exp] 68 / 4e-14 AT1G15360 181 / 3e-58 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.018G028000 [exp] 67 / 1e-13 AT5G11190 204 / 8e-68 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.006G253800 [exp] 67 / 2e-13 AT5G11190 197 / 1e-64 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.006G069400 [exp] 66 / 3e-13 AT1G15360 186 / 9e-60 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.004G047600 [exp] 52 / 5e-08 AT5G44210 99 / 2e-25 ERF DOMAIN PROTEIN- 9, erf domain protein 9 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10041614 pacid=23146708 polypeptide=Lus10041614 locus=Lus10041614.g ID=Lus10041614.BGIv1.0 annot-version=v1.0 ATGGCGACTAGGCAGCAGCAGCAGCAACAACAACGATACCGTGGGGTCCGCCAGCGCCATTGGGGTTCCTGGGTCTCCGAAATTCGCCACCCTCTTCTGA AGACGAGAATATGGCTGGGGACGTTCGAGTCGGCGGAAGACGCAGCAAGAGCGTACGACGAAGCAGCCCGCCTTATGTGTGGGCCTAAAGCTCGGACTAA TTTTCCATACAGCCCGGCTCATGACCAAGCCCAAGCCCAGTCTTCTTCTACTTCTACTTCAAGCTTTCTCACGGGAGCGCTGGCCGCCAAGCTCCACAAA TGCCACATGGCCTCTCTTCGAAGAATACCGCTCTCTTCCGCCAAGAAAAACAACTCCAAGAGCAAACCTCGTCATTACACAAATACTTCTTCTTCGAATT CTACTAATGCAGTCAAAAATGAATTTGCAATTGATAAACATCACGAAGCAGCGCAATGCGGCGGCTGCGGCAGTAGGGACAGGGGAAGAAGTTGGGACGA CAATGGCAGAGGAAGTTTGGAGAGGGGGGATCAAGCGACGGCGGGGGAGGTTGGTGCTGATGATGACATTATAATAGAGCAGATGATAGAGGAATTGCTC GATTCTGGCACCTCCATTGAGCTTTCTCTTGTTACTAAACATCATCCTTGTCATTAA
AA sequence Show only first row Show all	>Lus10041614 pacid=23146708 polypeptide=Lus10041614 locus=Lus10041614.g ID=Lus10041614.BGIv1.0 annot-version=v1.0 MATRQQQQQQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFESAEDAARAYDEAARLMCGPKARTNFPYSPAHDQAQAQSSSTSTSSFLTGALAAKLHK CHMASLRRIPLSSAKKNNSKSKPRHYTNTSSSNSTNAVKNEFAIDKHHEAAQCGGCGSRDRGRSWDDNGRGSLERGDQATAGEVGADDDIIIEQMIEELL DSGTSIELSLVTKHHPCH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G25190	AP2_ERF	ESE3	ethylene and salt inducible 3,...		Lus10041614 [exp]	0	1
AT3G49700		AtACS9, ACS9, E...	ETHYLENE OVERPRODUCING 3, 1-am...		Lus10007714 [exp]	1.0	0.8506
AT1G31930		XLG3	extra-large GTP-binding protei...		Lus10042206 [exp]	4.0	0.7014
					Lus10025954 [exp]	5.7	0.7586
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10000190 [exp]	6.2	0.7745
					Lus10024618 [exp]	8.9	0.7416
AT4G31970		CYP82C2, JAH1	"cytochrome P450, family 82, s...		Lus10028217 [exp]	12.1	0.7306
AT5G49360		ATBXL1, BXL1	beta-xylosidase 1 (.1)		Lus10037728 [exp]	13.3	0.7304
AT1G63990		SPO11-2	sporulation 11-2 (.1)		Lus10024675 [exp]	14.7	0.7145
AT4G13230			Late embryogenesis abundant pr...		Lus10022822 [exp]	16.7	0.7107
					Lus10010697 [exp]	17.5	0.7107

Compare expression of checked genes

Lus10041614 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.