Lus10041777 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G17760 243 / 7e-79 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT3G50930 238 / 4e-76 BCS1 cytochrome BC1 synthesis (.1)
AT3G50940 230 / 1e-74 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G17740 230 / 1e-73 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT2G18193 225 / 4e-72 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G17750 222 / 6e-72 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G17730 221 / 7e-71 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT2G18190 211 / 2e-66 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT3G28600 206 / 1e-64 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT1G43910 204 / 3e-64 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003213 252 / 3e-82 AT5G17740 430 / 7e-146 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10025989 243 / 4e-80 AT3G50930 445 / 1e-153 cytochrome BC1 synthesis (.1)
Lus10014284 244 / 2e-79 AT3G50930 535 / 0.0 cytochrome BC1 synthesis (.1)
Lus10037004 237 / 8e-77 AT3G50930 457 / 9e-159 cytochrome BC1 synthesis (.1)
Lus10015802 236 / 1e-76 AT3G50940 462 / 9e-161 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10024275 218 / 5e-69 AT3G50940 434 / 2e-149 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10007391 216 / 1e-68 AT3G50940 424 / 2e-145 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10014496 196 / 2e-60 AT5G40010 577 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
Lus10031318 196 / 2e-60 AT2G18193 415 / 1e-140 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G119900 250 / 6e-82 AT5G17760 512 / 3e-179 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.007G020800 249 / 2e-81 AT5G17760 506 / 1e-176 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.007G020600 227 / 1e-72 AT2G18193 553 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.008G177200 225 / 4e-72 AT3G50940 401 / 4e-136 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.007G020900 225 / 5e-72 AT3G50930 561 / 0.0 cytochrome BC1 synthesis (.1)
Potri.007G020500 221 / 7e-71 AT2G18193 511 / 1e-179 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.009G119066 222 / 3e-70 AT3G50930 471 / 4e-161 cytochrome BC1 synthesis (.1)
Potri.010G057900 218 / 6e-70 AT3G50930 396 / 1e-133 cytochrome BC1 synthesis (.1)
Potri.009G119132 219 / 1e-69 AT3G50930 484 / 3e-166 cytochrome BC1 synthesis (.1)
Potri.005G119200 218 / 4e-69 AT1G43910 530 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00004 AAA ATPase family associated with various cellular activities (AAA)
Representative CDS sequence
>Lus10041777 pacid=23146940 polypeptide=Lus10041777 locus=Lus10041777.g ID=Lus10041777.BGIv1.0 annot-version=v1.0
ATGACTACATGGAGTTCGGTGACAATGGATCACCCTGCGAATTTCGTCTCTCTGGCGATGGAGCTGTCCCTCAAGGAGGCAGTAGTTCGAGATCTCGACA
GGTTTCGAAATAGAAAAGACTTTTACAAACAGGTGGGACGCGCTGGGAAGCGTGGCTATTTGCTACACGGCCCGCCCGGGACAGGGAAATCGAGTCTAGT
TGCTGCCATGGCTAATTACTTGAAGTTTGATGTCTACAATTTGCAGCTCGCCAGCATCACTAGCGACTCCGAACTCCGACGACTTTTAACTGCCATGGGG
AATAGGTCCATCCTCGTCATTGAAGACATTGATTGTAGCTGGGATTTGCCCGATCGGACCACCAACGACAATGTTGATTCAAAAATGAAAAAGGAGGAGA
TAACATTGGTGGGGTTGCTGAATTACATCGACGGATTGTGGTTGAGTTGCGGGGACGAGAGGATCATAGTGATCACAACCAACCACAAGGAGAAGCTGGA
CCCGGCACTGCTTCGGCCGGGTTGA
AA sequence
>Lus10041777 pacid=23146940 polypeptide=Lus10041777 locus=Lus10041777.g ID=Lus10041777.BGIv1.0 annot-version=v1.0
MTTWSSVTMDHPANFVSLAMELSLKEAVVRDLDRFRNRKDFYKQVGRAGKRGYLLHGPPGTGKSSLVAAMANYLKFDVYNLQLASITSDSELRRLLTAMG
NRSILVIEDIDCSWDLPDRTTNDNVDSKMKKEEITLVGLLNYIDGLWLSCGDERIIVITTNHKEKLDPALLRPG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G17760 P-loop containing nucleoside t... Lus10041777 0 1
Lus10003448 5.1 0.8017
AT3G54200 Late embryogenesis abundant (L... Lus10039665 6.9 0.7919
AT1G17800 AtENODL22 early nodulin-like protein 22 ... Lus10020984 9.6 0.7458
AT5G17730 P-loop containing nucleoside t... Lus10041778 10.2 0.6445
Lus10005203 10.6 0.6896
AT1G17930 Aminotransferase-like, plant m... Lus10021566 11.7 0.7412
Lus10000325 13.0 0.7412
Lus10002099 14.3 0.7412
Lus10011594 15.4 0.7412
Lus10025316 16.5 0.7412

Lus10041777 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.