Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02850 130 / 4e-40 ARPN plantacyanin (.1) AT3G17675 89 / 6e-24 Cupredoxin superfamily protein (.1) AT1G17800 88 / 3e-23 AtENODL22 early nodulin-like protein 22 (.1) AT3G60270 81 / 4e-20 Cupredoxin superfamily protein (.1) AT2G44790 80 / 1e-19 UCC2 uclacyanin 2 (.1) AT5G26330 79 / 2e-19 Cupredoxin superfamily protein (.1) AT5G07475 78 / 8e-19 Cupredoxin superfamily protein (.1) AT3G27200 77 / 1e-18 Cupredoxin superfamily protein (.1) AT2G32300 76 / 2e-17 UCC1 uclacyanin 1 (.1) AT2G26720 74 / 4e-17 Cupredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041850 [exp] 196 / 3e-66 AT2G02850 121 / 1e-36 plantacyanin (.1) Lus10041849 [exp] 191 / 4e-64 AT2G02850 130 / 5e-40 plantacyanin (.1) Lus10028640 [exp] 124 / 1e-37 AT2G02850 151 / 3e-48 plantacyanin (.1) Lus10028641 [exp] 124 / 1e-37 AT2G02850 151 / 3e-48 plantacyanin (.1) Lus10018938 [exp] 124 / 2e-37 AT2G02850 151 / 2e-48 plantacyanin (.1) Lus10028396 [exp] 119 / 7e-36 AT2G02850 107 / 4e-31 plantacyanin (.1) Lus10022800 [exp] 114 / 1e-33 AT2G02850 100 / 4e-28 plantacyanin (.1) Lus10028395 [exp] 108 / 1e-31 AT2G02850 107 / 2e-31 plantacyanin (.1) Lus10011867 [exp] 112 / 6e-30 AT3G07060 621 / 0.0 embryo defective 1974, NHL domain-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G209300 [exp] 146 / 2e-46 AT2G02850 155 / 4e-50 plantacyanin (.1) Potri.002G074000 [exp] 137 / 5e-43 AT2G02850 154 / 1e-49 plantacyanin (.1) Potri.002G241500 [exp] 124 / 1e-37 AT2G02850 122 / 8e-37 plantacyanin (.1) Potri.008G151000 [exp] 97 / 4e-26 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1) Potri.010G089900 [exp] 95 / 1e-25 AT5G26330 187 / 7e-61 Cupredoxin superfamily protein (.1) Potri.007G104600 [exp] 89 / 1e-23 AT1G17800 94 / 3e-25 early nodulin-like protein 22 (.1) Potri.003G047300 [exp] 89 / 9e-23 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1) Potri.006G259101 [exp] 86 / 2e-22 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1) Potri.002G156401 [exp] 86 / 4e-22 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1) Potri.002G156100 [exp] 86 / 4e-22 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [flax] [poplar] CU_oxidase PF02298 [flax] [poplar] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Lus10041848 pacid=23146817 polypeptide=Lus10041848 locus=Lus10041848.g ID=Lus10041848.BGIv1.0 annot-version=v1.0 ATGAAGGTTGCTTTTGCAATAGTGTTGTTGACAATGGCACTGCTCATGTTTGTTCAGCTGAAGACTACCGTCGACGCAGCCACCTATACCGTCGGCGACG CAGGAGGCTGGGGATTCGGTCCTGTCAGCAGTTGGCCGCAGGGAAAGAGTTTCAAGGCCGGTGACATACTTGTTTTCAAGTACCCGTCGCCGCTGCACAA CGTGGCGGTGGTTGACAGTAATGGTTACAGTGGTTGCACGGCGCCGTCGGGCGCTCCGGTTTTCAGTTCCGGCAACGATCAAATAACCCTCGCCAAAGGA CAAAATTTCTTCATCTGTAGCATCCCTGGCCATTGTCAAGCTGGCGTCAAAGTTGCTGTCAATGCTGCTTGA
AA sequence Show only first row Show all	>Lus10041848 pacid=23146817 polypeptide=Lus10041848 locus=Lus10041848.g ID=Lus10041848.BGIv1.0 annot-version=v1.0 MKVAFAIVLLTMALLMFVQLKTTVDAATYTVGDAGGWGFGPVSSWPQGKSFKAGDILVFKYPSPLHNVAVVDSNGYSGCTAPSGAPVFSSGNDQITLAKG QNFFICSIPGHCQAGVKVAVNAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02850		ARPN	plantacyanin (.1)		Lus10041848 [exp]	0	1
AT5G52390			PAR1 protein (.1)		Lus10018204 [exp]	7.5	0.9009
AT5G25180		CYP71B14	"cytochrome P450, family 71, s...		Lus10033634 [exp]	9.1	0.8771
AT1G29970		RPL18AA	60S ribosomal protein L18A-1 (...		Lus10026180 [exp]	13.6	0.8674
					Lus10017959 [exp]	15.1	0.8433
					Lus10001476 [exp]	15.3	0.8377
AT4G33860			Glycosyl hydrolase family 10 p...		Lus10033787 [exp]	18.2	0.8418
AT1G54140		TAF9, TAFII21	TBP-ASSOCIATED FACTOR 9, TATA ...		Lus10001863 [exp]	18.8	0.7809
					Lus10009411 [exp]	19.6	0.8364
AT1G28220		ATPUP3	purine permease 3 (.1)		Lus10008212 [exp]	23.7	0.8200
AT2G02360		ATPP2-B10	phloem protein 2-B10 (.1)		Lus10025660 [exp]	24.0	0.8196

Compare expression of checked genes

Lus10041848 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.