Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02850 121 / 1e-36 ARPN plantacyanin (.1) AT5G26330 83 / 7e-21 Cupredoxin superfamily protein (.1) AT3G17675 81 / 7e-21 Cupredoxin superfamily protein (.1) AT3G60270 80 / 8e-20 Cupredoxin superfamily protein (.1) AT2G26720 76 / 5e-18 Cupredoxin superfamily protein (.1) AT1G17800 74 / 6e-18 AtENODL22 early nodulin-like protein 22 (.1) AT3G27200 75 / 8e-18 Cupredoxin superfamily protein (.1) AT2G32300 74 / 9e-17 UCC1 uclacyanin 1 (.1) AT2G31050 71 / 6e-16 Cupredoxin superfamily protein (.1) AT5G07475 68 / 6e-15 Cupredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041849 [exp] 209 / 2e-71 AT2G02850 130 / 5e-40 plantacyanin (.1) Lus10041848 [exp] 196 / 4e-66 AT2G02850 130 / 4e-40 plantacyanin (.1) Lus10028396 [exp] 123 / 2e-37 AT2G02850 107 / 4e-31 plantacyanin (.1) Lus10028395 [exp] 122 / 3e-37 AT2G02850 107 / 2e-31 plantacyanin (.1) Lus10018938 [exp] 120 / 3e-36 AT2G02850 151 / 2e-48 plantacyanin (.1) Lus10028640 [exp] 119 / 6e-36 AT2G02850 151 / 3e-48 plantacyanin (.1) Lus10028641 [exp] 119 / 6e-36 AT2G02850 151 / 3e-48 plantacyanin (.1) Lus10022800 [exp] 114 / 6e-34 AT2G02850 100 / 4e-28 plantacyanin (.1) Lus10011867 [exp] 112 / 7e-30 AT3G07060 621 / 0.0 embryo defective 1974, NHL domain-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G074000 [exp] 136 / 1e-42 AT2G02850 154 / 1e-49 plantacyanin (.1) Potri.001G209300 [exp] 133 / 2e-41 AT2G02850 155 / 4e-50 plantacyanin (.1) Potri.002G241500 [exp] 130 / 3e-40 AT2G02850 122 / 8e-37 plantacyanin (.1) Potri.008G151000 [exp] 98 / 8e-27 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1) Potri.010G089900 [exp] 95 / 2e-25 AT5G26330 187 / 7e-61 Cupredoxin superfamily protein (.1) Potri.003G047300 [exp] 95 / 3e-25 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1) Potri.009G136200 [exp] 87 / 2e-22 AT5G26330 88 / 4e-22 Cupredoxin superfamily protein (.1) Potri.002G156401 [exp] 86 / 5e-22 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1) Potri.002G156100 [exp] 86 / 5e-22 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1) Potri.006G259000 [exp] 86 / 6e-22 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [flax] [poplar] CU_oxidase PF02298 [flax] [poplar] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Lus10041850 pacid=23147067 polypeptide=Lus10041850 locus=Lus10041850.g ID=Lus10041850.BGIv1.0 annot-version=v1.0 ATGAAGGGTGTTGTTGCAATAGTGTGGTCGACAGTGGCACTGCTCATGTTTGTTCAGCTGAAGACTACCGTCGACGCAGCCAGCTATACCGTCGGCGAGG CAAAGGGTTGGGGATTCGGCATTGGCAGTTGGCCGCAGAAAAAGAGTTTCAAAGCCGGTGACACACTTGTTTTCAAGTATCCGTCAAATCTCCACAATGT GGCGGTGGTTGACAGTAGTGGTTACAGTGGCTGTACGACGCCGCCGGGCGCGTCGGTTTACACTTCCGGCAACGATCAAATAACCCTGGCCAAAGGACAG AGTTATTTCATCTGTAACATCCCTGGCCATTGTCAAGCCGGGGTCAAAATTTCTGTCAATGCTTCTTAA
AA sequence Show only first row Show all	>Lus10041850 pacid=23147067 polypeptide=Lus10041850 locus=Lus10041850.g ID=Lus10041850.BGIv1.0 annot-version=v1.0 MKGVVAIVWSTVALLMFVQLKTTVDAASYTVGEAKGWGFGIGSWPQKKSFKAGDTLVFKYPSNLHNVAVVDSSGYSGCTTPPGASVYTSGNDQITLAKGQ SYFICNIPGHCQAGVKISVNAS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02850		ARPN	plantacyanin (.1)		Lus10041850 [exp]	0	1
AT5G17010			Major facilitator superfamily ...		Lus10009573 [exp]	5.1	0.9252
AT1G07590			Tetratricopeptide repeat (TPR)...		Lus10029724 [exp]	5.2	0.8943
AT3G04120		GAPC1, GAPC-1, ...	glyceraldehyde-3-phosphate deh...		Lus10015826 [exp]	5.7	0.9366
AT5G55410			Bifunctional inhibitor/lipid-t...		Lus10016582 [exp]	9.9	0.8779
AT4G19710		AK-HSDHII, AK-H...	aspartate kinase-homoserine de...		Lus10041071 [exp]	12.6	0.9127
AT2G44990		MAX3, CCD7, ATC...	carotenoid cleavage dioxygenas...		Lus10021241 [exp]	15.8	0.9180
AT5G13490		AAC2	ADP/ATP carrier 2 (.1.2)		Lus10019702 [exp]	16.1	0.8944
AT1G47870	E2F_DP	ATE2FC, ATE2F2,...	ARABIDOPSIS THALIANA HOMOLOG O...		Lus10033151 [exp]	20.5	0.9038
AT4G09820	bHLH	BHLH42, TT8, bH...	TRANSPARENT TESTA 8, basic hel...		Lus10042572 [exp]	21.1	0.9050
AT2G43970			RNA-binding protein (.1.2)		Lus10025608 [exp]	21.4	0.8957

Compare expression of checked genes

Lus10041850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.