Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G76860 95 / 2e-26 Small nuclear ribonucleoprotein family protein (.1) AT1G21190 92 / 3e-25 Small nuclear ribonucleoprotein family protein (.1) AT3G62840 39 / 0.0002 Small nuclear ribonucleoprotein family protein (.1.2) AT2G47640 39 / 0.0002 Small nuclear ribonucleoprotein family protein (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026326 [exp] 102 / 1e-29 AT1G76860 176 / 4e-59 Small nuclear ribonucleoprotein family protein (.1) Lus10040487 [exp] 101 / 4e-29 AT1G76860 175 / 8e-59 Small nuclear ribonucleoprotein family protein (.1) Lus10011293 [exp] 101 / 4e-29 AT1G76860 175 / 8e-59 Small nuclear ribonucleoprotein family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G191600 [exp] 100 / 1e-28 AT1G76860 176 / 3e-59 Small nuclear ribonucleoprotein family protein (.1) Potri.002G068800 [exp] 100 / 1e-28 AT1G76860 175 / 1e-58 Small nuclear ribonucleoprotein family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [flax] [poplar] Sm-like PF01423 [flax] [poplar] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Lus10042341 pacid=23153494 polypeptide=Lus10042341 locus=Lus10042341.g ID=Lus10042341.BGIv1.0 annot-version=v1.0 ATGTCGACCGAAGAGGAGAGCGCAGTGAAGGAGCCTTTGGATCTCATCAGACTTAGTCTCGACGAACGCATCTACGTCAAGCTCCGTTCCGACCGAGAAC TCCGCGGCAAGCTTCATGCTTATGATCAGCATTTAAACATGATTCTTGGGGATGTTGAAGAAACTGTGACTACGGTGGAAATTGACGACGAAACTTATGA AGAGATTGTCAGGAGGAGATGGAGTCATATTGGTTTCTCCGCCATTGAGGACTGCTTGATATGGGAAGATGGAACTAAAGGTGCACCTCGGAATATGATT TTAGGAAAAGCCCTCTCTGTCACTGGAATGTGTCCAACTGTTACTGATCTCATCGATGATGTCTGA
AA sequence Show only first row Show all	>Lus10042341 pacid=23153494 polypeptide=Lus10042341 locus=Lus10042341.g ID=Lus10042341.BGIv1.0 annot-version=v1.0 MSTEEESAVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMILGDVEETVTTVEIDDETYEEIVRRRWSHIGFSAIEDCLIWEDGTKGAPRNMI LGKALSVTGMCPTVTDLIDDV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G76860			Small nuclear ribonucleoprotei...		Lus10042341 [exp]	0	1
AT1G61700			RNA polymerases N / 8 kDa subu...		Lus10025907 [exp]	4.2	0.8205
AT4G21800		QQT2	quatre-quart2, P-loop containi...		Lus10040022 [exp]	4.4	0.8529
AT2G35736			unknown protein		Lus10028935 [exp]	7.7	0.8372
AT5G12080		ATMSL10, MSL10	mechanosensitive channel of sm...		Lus10011954 [exp]	9.4	0.8009
AT2G37680		PAT3, FRY1, FHY...	unknown protein		Lus10023781 [exp]	9.6	0.8273
AT3G07750			3'-5'-exoribonuclease family p...		Lus10001173 [exp]	13.2	0.8231
AT5G53650			unknown protein		Lus10008848 [exp]	14.7	0.8313
AT2G04630		NRPE6B, NRPB6B	RNA polymerase Rpb6 (.1)		Lus10038878 [exp]	21.0	0.8159
AT4G21800		QQT2	quatre-quart2, P-loop containi...		Lus10019602 [exp]	28.8	0.8026
AT2G44860			Ribosomal protein L24e family ...		Lus10020552 [exp]	42.7	0.7949

Compare expression of checked genes

Lus10042341 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.