Lus10042557 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G23240 127 / 6e-37 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1)
AT1G06160 107 / 7e-29 AP2_ERF ORA59 octadecanoid-responsive Arabidopsis AP2/ERF 59 (.1)
AT2G31230 106 / 2e-28 AP2_ERF ATERF15 ethylene-responsive element binding factor 15 (.1)
AT5G51190 82 / 4e-19 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT3G23220 77 / 2e-18 AP2_ERF ESE1 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1)
AT5G47230 81 / 3e-18 AP2_ERF ATERF5, ATERF-5, ERF5 ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR- 5, ethylene responsive element binding factor 5 (.1)
AT3G23230 77 / 3e-18 AP2_ERF ERF98 Integrase-type DNA-binding superfamily protein (.1)
AT5G43410 77 / 4e-18 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G04370 76 / 9e-18 AP2_ERF ATERF14 Ethylene-responsive element binding factor 14 (.1)
AT4G17490 78 / 2e-17 AP2_ERF ERF-6-6, ATERF6 ethylene responsive element binding factor 6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022015 261 / 2e-89 AT3G23240 176 / 1e-55 ethylene response factor 1 (.1)
Lus10014655 150 / 1e-45 AT3G23240 202 / 3e-65 ethylene response factor 1 (.1)
Lus10006579 150 / 2e-45 AT3G23240 211 / 4e-69 ethylene response factor 1 (.1)
Lus10033885 118 / 8e-33 AT3G23240 142 / 7e-42 ethylene response factor 1 (.1)
Lus10003562 116 / 3e-32 AT3G23240 146 / 1e-43 ethylene response factor 1 (.1)
Lus10027469 111 / 1e-30 AT3G23240 145 / 2e-43 ethylene response factor 1 (.1)
Lus10021193 111 / 2e-30 AT3G23240 209 / 2e-68 ethylene response factor 1 (.1)
Lus10011829 111 / 3e-30 AT3G23240 209 / 4e-68 ethylene response factor 1 (.1)
Lus10022935 103 / 8e-27 AT2G31230 145 / 4e-42 ethylene-responsive element binding factor 15 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G045200 136 / 3e-40 AT3G23240 167 / 5e-52 ethylene response factor 1 (.1)
Potri.002G039100 130 / 5e-38 AT3G23240 147 / 3e-44 ethylene response factor 1 (.1)
Potri.019G014409 124 / 2e-35 AT3G23240 161 / 1e-49 ethylene response factor 1 (.1)
Potri.005G223200 123 / 3e-35 AT3G23240 165 / 4e-51 ethylene response factor 1 (.1)
Potri.005G223300 120 / 6e-34 AT3G23240 163 / 5e-50 ethylene response factor 1 (.1)
Potri.002G039000 109 / 1e-29 AT3G23240 138 / 2e-40 ethylene response factor 1 (.1)
Potri.008G166200 108 / 1e-29 AT3G23240 202 / 1e-65 ethylene response factor 1 (.1)
Potri.010G072300 108 / 3e-29 AT3G23240 201 / 2e-65 ethylene response factor 1 (.1)
Potri.008G166000 81 / 9e-20 AT3G23230 94 / 3e-25 Integrase-type DNA-binding superfamily protein (.1)
Potri.011G061700 82 / 1e-19 AT3G23240 111 / 1e-30 ethylene response factor 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Lus10042557 pacid=23181800 polypeptide=Lus10042557 locus=Lus10042557.g ID=Lus10042557.BGIv1.0 annot-version=v1.0
ATGCTCCTCTTTCGACTCCTCATCAACCACCAATCCGACTCCTCCTCCTCCTCCTCCGCCGAAGAACCATCCTCCTCCTACCCGCAGGATTCGGAAACTA
CGGCGGCGTACAGGGGAGTGAGGAAGAGGCCCTGGGGGAAGTACGCGGCGGAGATAAGGGACTCCACCAGGAACGGCGTCCGCGTCTGGCTGGGGACGTT
CGATACCGCGGAGGCTGCTGCCTTGGCGTACGATCAGGCGGCGTTTGCGCTCCGTGGTTCCATGGCGGTGCTGAATTTCTCCGCTGAGATAGCCAGGAGG
TCTCTCCTGGAGATTGGTTATAAAGGGGGGTGTTACTCTTCGCCGGTGCTGGAGCTGAAGAAGCGGAACTCGGCCATGAGGATGGCGGTGAGAGGGCGGA
GGAGTAAGAGGAAAGATAAGGCGGAGGTGGCGGCAGCAGAGGTTGAGGAAGGGACGTCGACGGTGGTGTTTGAGGATTTGGGAGCAGAGTATCTGGAGGA
AATTATGGCGATTGCCGAGAATACTAGTATTAGTAATGCTGATGATGATCAGCATTGGTGGTGA
AA sequence
>Lus10042557 pacid=23181800 polypeptide=Lus10042557 locus=Lus10042557.g ID=Lus10042557.BGIv1.0 annot-version=v1.0
MLLFRLLINHQSDSSSSSSAEEPSSSYPQDSETTAAYRGVRKRPWGKYAAEIRDSTRNGVRVWLGTFDTAEAAALAYDQAAFALRGSMAVLNFSAEIARR
SLLEIGYKGGCYSSPVLELKKRNSAMRMAVRGRRSKRKDKAEVAAAEVEEGTSTVVFEDLGAEYLEEIMAIAENTSISNADDDQHWW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G23240 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1... Lus10042557 0 1
AT4G29700 Alkaline-phosphatase-like fami... Lus10000041 4.6 0.9419
AT4G29680 Alkaline-phosphatase-like fami... Lus10034660 9.1 0.9405
AT1G74360 Leucine-rich repeat protein ki... Lus10003477 18.1 0.9382
AT5G20900 ZIM TIFY3B, JAZ12 jasmonate-zim-domain protein 1... Lus10027639 22.3 0.8992
AT3G23240 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1... Lus10011829 24.2 0.9364
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10027586 34.6 0.9314
AT2G02870 Galactose oxidase/kelch repeat... Lus10037196 40.6 0.9106
AT1G34210 ATSERK2, SERK2 somatic embryogenesis receptor... Lus10004958 44.5 0.9154
AT5G01250 alpha 1,4-glycosyltransferase ... Lus10027770 49.9 0.9295
AT2G45220 Plant invertase/pectin methyle... Lus10027202 50.9 0.9262

Lus10042557 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.