Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18372 154 / 7e-50 Small nuclear ribonucleoprotein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000241 [exp] 238 / 7e-83 AT4G18372 154 / 9e-50 Small nuclear ribonucleoprotein family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G138100 [exp] 161 / 7e-53 AT4G18372 159 / 4e-52 Small nuclear ribonucleoprotein family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [flax] [poplar] Sm-like PF01423 [flax] [poplar] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Lus10042823 pacid=23181975 polypeptide=Lus10042823 locus=Lus10042823.g ID=Lus10042823.BGIv1.0 annot-version=v1.0 ATGGAGACTGGACTGGAAATGGACAAGCCGCCTGGTCGAGAAGAAGGGAGCAGCGCAGAATGTAACAGCGAAGCAGGCATCTCGGATACTGTAGCTCGGG TGAAGAAATTGTTGTTTCGACAAATGCTGGTGGGAATAAAAGATGGGCGCTTTTTCATGGGGACGTTTCACTGCATGGATAAGCAAGGCAACATCATCCT TCAAGATGCTGTAGAATATCGTAGCACTCGACGGAATGCTCCTTCTCCGATGGAACAACGATGCCTTGGTCTGATTCTCATCCCTTTCTCAGCTAGAACA TCTTGTCACATCGAGTGTCAAATCGAGGAGCAAATGTCTCTGATGTCGGTTCAAGAGTAG
AA sequence Show only first row Show all	>Lus10042823 pacid=23181975 polypeptide=Lus10042823 locus=Lus10042823.g ID=Lus10042823.BGIv1.0 annot-version=v1.0 METGLEMDKPPGREEGSSAECNSEAGISDTVARVKKLLFRQMLVGIKDGRFFMGTFHCMDKQGNIILQDAVEYRSTRRNAPSPMEQRCLGLILIPFSART SCHIECQIEEQMSLMSVQE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G18372			Small nuclear ribonucleoprotei...		Lus10042823 [exp]	0	1
AT1G27350			Ribosome associated membrane p...		Lus10037031 [exp]	1.0	0.8649
AT5G64920		CIP8	COP1-interacting protein 8 (.1...		Lus10031422 [exp]	1.7	0.8440
AT2G37975			Yos1-like protein (.1)		Lus10000226 [exp]	2.8	0.8457
AT2G35900			unknown protein		Lus10021249 [exp]	6.6	0.8340
AT1G04760		ATVAMP726	vesicle-associated membrane pr...		Lus10040611 [exp]	7.1	0.7691
AT2G36930	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10023928 [exp]	8.9	0.8109
AT1G71780			unknown protein		Lus10040812 [exp]	9.4	0.7982
AT5G47200		AtRABD2b, AtRab...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Lus10004361 [exp]	9.4	0.7726
AT3G14460			LRR and NB-ARC domains-contain...		Lus10006793 [exp]	9.9	0.7995
AT1G53900			Eukaryotic translation initiat...		Lus10037451 [exp]	11.6	0.7924

Compare expression of checked genes

Lus10042823 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.