Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18220 155 / 2e-47 Drug/metabolite transporter superfamily protein (.1) AT4G18210 146 / 1e-43 ATPUP10 purine permease 10 (.1) AT1G44750 132 / 1e-38 ATPUP11 purine permease 11 (.1.2.3) AT4G18197 127 / 2e-36 PEX17, ATPUP7, AT4G18200 PEROXIN 17, ARABIDOPSIS THALIANA PURINE PERMEASE 7, purine permease 7 (.1) AT4G18205 117 / 9e-33 AT4G18200 Nucleotide-sugar transporter family protein (.1) AT4G18195 117 / 1e-32 ATPUP8, AT4G18200 ARABIDOPSIS THALIANA PURINE PERMEASE 8, purine permease 8 (.1) AT4G08700 106 / 2e-28 ATPUP13 Drug/metabolite transporter superfamily protein (.1) AT4G18190 104 / 9e-28 ATPUP6 purine permease 6 (.1) AT5G41160 97 / 5e-25 ATPUP12 ARABIDOPSIS THALIANA PURINE PERMEASE 12, purine permease 12 (.1) AT1G19770 86 / 1e-20 ATPUP14 purine permease 14 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028132 [exp] 228 / 2e-74 AT4G18220 361 / 4e-123 Drug/metabolite transporter superfamily protein (.1) Lus10040118 [exp] 148 / 3e-44 AT4G18210 336 / 2e-113 purine permease 10 (.1) Lus10030927 [exp] 146 / 1e-43 AT4G18210 336 / 1e-113 purine permease 10 (.1) Lus10026130 [exp] 146 / 2e-43 AT4G18210 382 / 2e-131 purine permease 10 (.1) Lus10008689 [exp] 145 / 2e-43 AT4G18210 382 / 3e-131 purine permease 10 (.1) Lus10023317 [exp] 123 / 5e-37 AT4G18210 150 / 3e-45 purine permease 10 (.1) Lus10043350 [exp] 121 / 9e-34 AT1G44750 456 / 8e-161 purine permease 11 (.1.2.3) Lus10019503 [exp] 117 / 1e-32 AT1G44750 452 / 1e-159 purine permease 11 (.1.2.3) Lus10038492 [exp] 107 / 8e-29 AT4G18210 344 / 3e-116 purine permease 10 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G352200 [exp] 170 / 6e-53 AT4G18220 315 / 1e-105 Drug/metabolite transporter superfamily protein (.1) Potri.001G352100 [exp] 154 / 2e-46 AT4G18210 398 / 1e-137 purine permease 10 (.1) Potri.001G147600 [exp] 150 / 5e-45 AT4G18210 315 / 7e-105 purine permease 10 (.1) Potri.014G043900 [exp] 139 / 4e-41 AT1G44750 434 / 2e-152 purine permease 11 (.1.2.3) Potri.005G160300 [exp] 86 / 4e-21 AT1G28220 413 / 8e-145 purine permease 3 (.1) Potri.006G184900 [exp] 67 / 5e-14 AT2G24220 404 / 6e-141 purine permease 5 (.1.2) Potri.002G099600 [exp] 54 / 2e-09 AT1G28220 229 / 2e-72 purine permease 3 (.1) Potri.001G074100 [exp] 50 / 3e-08 AT1G30840 303 / 5e-101 purine permease 4 (.1.2) Potri.003G156900 [exp] 49 / 1e-07 AT1G30840 323 / 4e-108 purine permease 4 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0184 [flax] [poplar] DMT PF03151 [flax] [poplar] TPT Triose-phosphate Transporter family
Representative CDS sequence Show only first row Show all	>Lus10042836 pacid=23182018 polypeptide=Lus10042836 locus=Lus10042836.g ID=Lus10042836.BGIv1.0 annot-version=v1.0 ATGGGAAGCGGGGAGTGGAAGGGTATAAGTAAGGAAATGGAAGGATTTGAAACGGGGGAAGTTTCGTACGTGATGACGTTGGTTTGGACTGCAATTTGTT GGCAGGTTTACTCCATTGGTTGCGTTGGGTTGATATTTGAGGTGTCGTCTCTGTTCTCCAATGTTATTGGGACGTTTGGATTGCCGCTTGTTCCGGTTCT GGCGGTGTTCTTTTTCAGGGATAGGATGGACGGTTTGAAGGCGGTGGCTATGGTTTTGGCTGTTTGGGGTTTTGTTTCGTATGTGTATCAGCATTATCTT GACCACCATCAAGGAGAAGGAGGAGGAGGAGGAGTCGCCGATGACCGGGAAGAATCCGGTTGA
AA sequence Show only first row Show all	>Lus10042836 pacid=23182018 polypeptide=Lus10042836 locus=Lus10042836.g ID=Lus10042836.BGIv1.0 annot-version=v1.0 MGSGEWKGISKEMEGFETGEVSYVMTLVWTAICWQVYSIGCVGLIFEVSSLFSNVIGTFGLPLVPVLAVFFFRDRMDGLKAVAMVLAVWGFVSYVYQHYL DHHQGEGGGGGVADDREESG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G18220			Drug/metabolite transporter su...		Lus10042836 [exp]	0	1
AT5G50400		ATPAP27, PAP27	ARABIDOPSIS THALIANA PURPLE AC...		Lus10019772 [exp]	37.1	0.6978
					Lus10006591 [exp]	55.7	0.7689
AT3G25400			unknown protein		Lus10015730 [exp]	58.2	0.7321
AT3G54200			Late embryogenesis abundant (L...		Lus10018361 [exp]	74.0	0.7643
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10009688 [exp]	77.7	0.7635
					Lus10033006 [exp]	114.8	0.7376
AT4G37810			unknown protein		Lus10011591 [exp]	123.8	0.6926
AT5G45650			subtilase family protein (.1)		Lus10020458 [exp]	125.0	0.7449
AT2G45460	FHA		SMAD/FHA domain-containing pro...		Lus10009303 [exp]	129.1	0.6948
AT5G20320		DCL4, ATDCL4	dicer-like 4 (.1.2)		Lus10019587 [exp]	189.4	0.6918

Compare expression of checked genes

Lus10042836 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.