Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G65700 158 / 5e-52 Small nuclear ribonucleoprotein family protein (.1.2.3) AT1G19120 56 / 4e-11 Small nuclear ribonucleoprotein family protein (.1) AT3G14080 53 / 5e-10 Small nuclear ribonucleoprotein family protein (.1.2) AT2G03870 43 / 2e-06 EMB2816 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) AT3G11500 38 / 0.0001 Small nuclear ribonucleoprotein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028183 [exp] 206 / 5e-71 AT1G65700 155 / 8e-51 Small nuclear ribonucleoprotein family protein (.1.2.3) Lus10008124 [exp] 49 / 3e-08 AT3G14080 236 / 3e-82 Small nuclear ribonucleoprotein family protein (.1.2) Lus10035639 [exp] 45 / 2e-07 AT2G03870 179 / 3e-60 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Lus10017019 [exp] 40 / 3e-05 AT3G11500 150 / 2e-49 Small nuclear ribonucleoprotein family protein (.1) Lus10021342 [exp] 38 / 0.0001 AT3G11500 152 / 3e-50 Small nuclear ribonucleoprotein family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G278000 [exp] 169 / 4e-56 AT1G65700 146 / 3e-47 Small nuclear ribonucleoprotein family protein (.1.2.3) Potri.003G068400 [exp] 47 / 8e-08 AT3G14080 234 / 3e-81 Small nuclear ribonucleoprotein family protein (.1.2) Potri.001G166600 [exp] 47 / 9e-08 AT3G14080 233 / 9e-81 Small nuclear ribonucleoprotein family protein (.1.2) Potri.001G269500 [exp] 42 / 3e-06 AT2G03870 183 / 8e-62 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Potri.009G064000 [exp] 42 / 3e-06 AT2G03870 183 / 8e-62 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Potri.006G211100 [exp] 38 / 0.0001 AT3G11500 153 / 2e-50 Small nuclear ribonucleoprotein family protein (.1) Potri.016G078100 [exp] 37 / 0.0002 AT3G11500 152 / 5e-50 Small nuclear ribonucleoprotein family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [flax] [poplar] Sm-like PF01423 [flax] [poplar] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Lus10042884 pacid=23181686 polypeptide=Lus10042884 locus=Lus10042884.g ID=Lus10042884.BGIv1.0 annot-version=v1.0 ATGGCTTCTGGTCTTGGACTCGAATCTCTTGTTGACCAAACCATATCTGTGATCACAAATGATGGCCGCAACATAGTGGGCAACTTGAAAGGCTTCGATC AGGCCACAAATATCATCCTCGATGAATCCCATGAACGTGTTTACTCCACCAAGGAAGGCGTGCAACAACTGGTTTTGGGCTTGTACATAATAAGGGGTTG CTCCTTCTTCCAATGTTACAGAAGCGTGATTGGGGAGCTTGACGAGGAACTTGATGCGCACCTTGATATGTCGAATCTCAGAGCACATCCCCTCAAGCCT GTGATTCATTGA
AA sequence Show only first row Show all	>Lus10042884 pacid=23181686 polypeptide=Lus10042884 locus=Lus10042884.g ID=Lus10042884.BGIv1.0 annot-version=v1.0 MASGLGLESLVDQTISVITNDGRNIVGNLKGFDQATNIILDESHERVYSTKEGVQQLVLGLYIIRGCSFFQCYRSVIGELDEELDAHLDMSNLRAHPLKP VIH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G65700			Small nuclear ribonucleoprotei...		Lus10042884 [exp]	0	1
AT3G55280		RPL23A2, RPL23A...	RIBOSOMAL PROTEIN L23A2, ribos...		Lus10030325 [exp]	2.0	0.9401
AT1G72210	bHLH	bHLH096	basic helix-loop-helix (bHLH) ...		Lus10015902 [exp]	5.3	0.9120
AT3G49470		NACA2	nascent polypeptide-associated...		Lus10015579 [exp]	8.5	0.9058
AT3G22680		RDM1	RNA-DIRECTED DNA METHYLATION 1...		Lus10039354 [exp]	8.7	0.8928
AT2G21060		ATCSP4, ATGRP2B	COLD SHOCK DOMAIN PROTEIN 4, g...		Lus10034487 [exp]	9.2	0.8975
AT2G33620	AT-hook		AT hook motif DNA-binding fami...		Lus10000315 [exp]	12.7	0.8814
AT4G34860		A/N-InvB	alkaline/neutral invertase B, ...		Lus10026284 [exp]	19.0	0.8690
AT2G25970			KH domain-containing protein (...		Lus10023854 [exp]	19.6	0.8853
AT5G62390		ATBAG7	BCL-2-associated athanogene 7 ...		Lus10031147 [exp]	23.6	0.8752
AT1G19990			unknown protein		Lus10033141 [exp]	24.5	0.8804

Compare expression of checked genes

Lus10042884 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.