Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G15360 134 / 2e-39 AP2_ERF WIN1, SHN1 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) AT5G25390 113 / 2e-31 AP2_ERF SHN3, SHN2 shine3, Integrase-type DNA-binding superfamily protein (.1.2) AT5G11190 112 / 8e-31 AP2_ERF SHN2, SHN3 shine2, Integrase-type DNA-binding superfamily protein (.1) AT5G25190 43 / 4e-05 AP2_ERF ESE3 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) AT1G03800 42 / 0.0002 AP2_ERF AtERF10 ARABIDOPSIS THALIANA RF DOMAIN PROTEIN 10, ERF domain protein 10 (.1) AT2G47520 41 / 0.0002 AP2_ERF AtERF71, ERF71, HRE2 HYPOXIA RESPONSIVE ERF \(ETHYLENE RESPONSE FACTOR\) 2, Arabidopsis thaliana ethylene response factor 71, Integrase-type DNA-binding superfamily protein (.1) AT1G28370 40 / 0.0005 AP2_ERF AtERF11 ERF domain protein 11 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019414 [exp] 259 / 7e-88 AT1G15360 207 / 1e-67 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10030097 [exp] 175 / 7e-55 AT1G15360 234 / 1e-78 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10005716 [exp] 166 / 1e-51 AT1G15360 236 / 3e-79 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10009480 [exp] 129 / 9e-38 AT1G15360 207 / 1e-68 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10003506 [exp] 110 / 1e-30 AT1G15360 105 / 3e-29 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10002015 [exp] 105 / 3e-28 AT1G15360 183 / 4e-59 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10002912 [exp] 100 / 5e-26 AT5G25390 187 / 6e-61 shine3, Integrase-type DNA-binding superfamily protein (.1.2) Lus10041023 [exp] 46 / 6e-06 AT5G25190 205 / 7e-68 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10016815 [exp] 44 / 3e-05 AT5G25190 206 / 1e-68 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G131400 [exp] 165 / 3e-51 AT1G15360 194 / 6e-63 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.006G069400 [exp] 159 / 6e-49 AT1G15360 186 / 9e-60 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.018G028000 [exp] 135 / 7e-40 AT5G11190 204 / 8e-68 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.006G253800 [exp] 129 / 3e-37 AT5G11190 197 / 1e-64 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.003G033000 [exp] 120 / 2e-34 AT1G15360 181 / 3e-58 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.003G179900 [exp] 48 / 7e-07 AT5G25190 100 / 1e-26 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.018G021900 [exp] 46 / 5e-06 AT5G25190 169 / 1e-53 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.006G261200 [exp] 45 / 8e-06 AT5G25190 169 / 9e-54 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.001G048200 [exp] 43 / 5e-05 AT5G25190 162 / 5e-51 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.013G158500 [exp] 40 / 0.0005 AT4G27950 124 / 1e-32 cytokinin response factor 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10043271 pacid=23168086 polypeptide=Lus10043271 locus=Lus10043271.g ID=Lus10043271.BGIv1.0 annot-version=v1.0 ATGTACGGTTTCAGTTCCACTGGACTAATTTCAGCATTCAAGTTTCTGTCCGAATTCTGGAAAAGGATAAACAGAAGAGACTGCTTACAAACAGTATCCA GCTCTACACGAACTATCATCACTGGAGAACTACATGGCTATTTCAGGAAACGGAGGATCTGGCTAGGGACATTCGAGACGGCGGAGGAAGCTGCAAGAGC ATACGACCAAGCCGCAATCCTAATGAGTGGCCGGAACGCCAAGACCAACTTCCCCATCTCTCAATTCCCCCACTCCGGTGAAACCACACAACCGAATAAT GGGCTTTCGGAATTACTCCAAGCCAAGGTCCGGAGGTGCAGTAAGAAGCCTTCGCCGTCGATGACGTGCCTGAGGCTGGACACCGAGAACTCTCACATTG GGGTGTGGCAGAAACGCGCGGGGAAGAGGTCGGATTCCAATTGGGTCATGATAGTGAAAATGGAAGGAGACCGATCTTCTTCGTCATCGGAAGTAAACCA GGCGAAGGTAGGAGGAGTCGAGGACATTGTGATCAACAGCAAAGATGAGAATTCGGGAATACAGACGCTGGCAGATCCGGTGTCGGGAATCAGAAGGGAA ATGGAGGAAGAGAAGAGGATAGCACTGCAGATGATTGATGAGCTTCTGATCCGGAATTGA
AA sequence Show only first row Show all	>Lus10043271 pacid=23168086 polypeptide=Lus10043271 locus=Lus10043271.g ID=Lus10043271.BGIv1.0 annot-version=v1.0 MYGFSSTGLISAFKFLSEFWKRINRRDCLQTVSSSTRTIITGELHGYFRKRRIWLGTFETAEEAARAYDQAAILMSGRNAKTNFPISQFPHSGETTQPNN GLSELLQAKVRRCSKKPSPSMTCLRLDTENSHIGVWQKRAGKRSDSNWVMIVKMEGDRSSSSSEVNQAKVGGVEDIVINSKDENSGIQTLADPVSGIRRE MEEEKRIALQMIDELLIRN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G15360	AP2_ERF	WIN1, SHN1	WAX INDUCER 1, SHINE 1, Integr...		Lus10043271 [exp]	0	1
AT5G50400		ATPAP27, PAP27	ARABIDOPSIS THALIANA PURPLE AC...		Lus10024179 [exp]	4.6	0.7496
AT2G21140		ATPRP2	proline-rich protein 2 (.1)		Lus10026281 [exp]	6.2	0.8013
					Lus10023767 [exp]	6.7	0.7973
AT1G58520		RXW8	lipases;hydrolases, acting on ...		Lus10004597 [exp]	9.2	0.7940
AT2G23945			Eukaryotic aspartyl protease f...		Lus10023451 [exp]	9.3	0.7980
AT3G62060			Pectinacetylesterase family pr...		Lus10007200 [exp]	9.9	0.7715
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Lus10035903 [exp]	11.8	0.7952
AT1G61100			disease resistance protein (TI...		Lus10018471 [exp]	13.5	0.7637
AT1G63800		UBC5	ubiquitin-conjugating enzyme 5...		Lus10042136 [exp]	13.8	0.7192
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10030646 [exp]	14.3	0.7910

Compare expression of checked genes

Lus10043271 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.