Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18210 99 / 3e-26 ATPUP10 purine permease 10 (.1) AT4G18220 93 / 2e-24 Drug/metabolite transporter superfamily protein (.1) AT4G18197 87 / 7e-22 PEX17, ATPUP7, AT4G18200 PEROXIN 17, ARABIDOPSIS THALIANA PURINE PERMEASE 7, purine permease 7 (.1) AT1G44750 79 / 3e-19 ATPUP11 purine permease 11 (.1.2.3) AT4G18205 77 / 1e-18 AT4G18200 Nucleotide-sugar transporter family protein (.1) AT4G18195 72 / 1e-16 ATPUP8, AT4G18200 ARABIDOPSIS THALIANA PURINE PERMEASE 8, purine permease 8 (.1) AT4G08700 70 / 8e-16 ATPUP13 Drug/metabolite transporter superfamily protein (.1) AT5G41160 68 / 3e-15 ATPUP12 ARABIDOPSIS THALIANA PURINE PERMEASE 12, purine permease 12 (.1) AT4G18190 61 / 1e-12 ATPUP6 purine permease 6 (.1) AT1G28220 60 / 2e-12 ATPUP3 purine permease 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023317 [exp] 92 / 9e-26 AT4G18210 150 / 3e-45 purine permease 10 (.1) Lus10042836 [exp] 91 / 2e-25 AT4G18220 155 / 2e-47 Drug/metabolite transporter superfamily protein (.1) Lus10040118 [exp] 92 / 8e-24 AT4G18210 336 / 2e-113 purine permease 10 (.1) Lus10030927 [exp] 92 / 1e-23 AT4G18210 336 / 1e-113 purine permease 10 (.1) Lus10028132 [exp] 91 / 2e-23 AT4G18220 361 / 4e-123 Drug/metabolite transporter superfamily protein (.1) Lus10008689 [exp] 89 / 2e-22 AT4G18210 382 / 3e-131 purine permease 10 (.1) Lus10026130 [exp] 88 / 3e-22 AT4G18210 382 / 2e-131 purine permease 10 (.1) Lus10038492 [exp] 82 / 3e-20 AT4G18210 344 / 3e-116 purine permease 10 (.1) Lus10019503 [exp] 76 / 5e-18 AT1G44750 452 / 1e-159 purine permease 11 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G147600 [exp] 99 / 2e-26 AT4G18210 315 / 7e-105 purine permease 10 (.1) Potri.001G352100 [exp] 94 / 1e-24 AT4G18210 398 / 1e-137 purine permease 10 (.1) Potri.014G043900 [exp] 89 / 9e-23 AT1G44750 434 / 2e-152 purine permease 11 (.1.2.3) Potri.001G352200 [exp] 87 / 6e-22 AT4G18220 315 / 1e-105 Drug/metabolite transporter superfamily protein (.1) Potri.005G160300 [exp] 54 / 5e-10 AT1G28220 413 / 8e-145 purine permease 3 (.1) Potri.006G184900 [exp] 51 / 5e-09 AT2G24220 404 / 6e-141 purine permease 5 (.1.2) Potri.001G074100 [exp] 44 / 2e-06 AT1G30840 303 / 5e-101 purine permease 4 (.1.2) Potri.003G156900 [exp] 41 / 2e-05 AT1G30840 323 / 4e-108 purine permease 4 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0184 [flax] [poplar] DMT PF03151 [flax] [poplar] TPT Triose-phosphate Transporter family
Representative CDS sequence Show only first row Show all	>Lus10043396 pacid=23167958 polypeptide=Lus10043396 locus=Lus10043396.g ID=Lus10043396.BGIv1.0 annot-version=v1.0 ATGTTTACCGTTGGGGTAATAGGGTTGGTGTATGAGGTGTCTTCCCTGTTCTCTAACGTGGTTGCTGCCGTCGGTTTGCCTCTAACTCCAATCGTGGCCG TTGTCTTCTTCCACGACCACATCGACGGTGCTAAGATGGTTTCCATGCTGCTGGCTGTTTGGGGTTTGCTTTCTTATCTTTACCAACAGTATATGGACGA TCGGAACGACCAATTGGAGCGGAATTAG
AA sequence Show only first row Show all	>Lus10043396 pacid=23167958 polypeptide=Lus10043396 locus=Lus10043396.g ID=Lus10043396.BGIv1.0 annot-version=v1.0 MFTVGVIGLVYEVSSLFSNVVAAVGLPLTPIVAVVFFHDHIDGAKMVSMLLAVWGLLSYLYQQYMDDRNDQLERN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G18220			Drug/metabolite transporter su...		Lus10043396 [exp]	0	1
AT4G24220		5[beta]-StR, 5[...	VEIN PATTERNING 1, Δ4,5-s...		Lus10039688 [exp]	7.1	0.9302
AT2G45510		CYP704A2	"cytochrome P450, family 704, ...		Lus10015018 [exp]	8.2	0.9467
AT4G31830			unknown protein		Lus10010682 [exp]	16.7	0.9254
AT1G11260		ATSTP1, STP1	sugar transporter 1 (.1)		Lus10042516 [exp]	18.1	0.9430
AT4G39780	AP2_ERF		Integrase-type DNA-binding sup...		Lus10019665 [exp]	19.2	0.9355
AT1G12110		CHL1-1, CHL1, B...	CHLORINA 1, ARABIDOPSIS THALIA...		Lus10024614 [exp]	19.3	0.9325
AT5G53110			RING/U-box superfamily protein...		Lus10032382 [exp]	19.4	0.9337
AT5G41810			unknown protein		Lus10003901 [exp]	23.6	0.9360
AT3G16990			Haem oxygenase-like, multi-hel...		Lus10037751 [exp]	26.6	0.9358
AT1G16390		3-Oct, ATOCT3	organic cation/carnitine trans...		Lus10005825 [exp]	28.1	0.9224

Compare expression of checked genes

Lus10043396 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.