Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G15350 121 / 3e-35 AtENODL17 early nodulin-like protein 17 (.1) AT4G12880 104 / 5e-29 AtENODL19 early nodulin-like protein 19 (.1.2) AT2G27035 99 / 2e-26 AtENODL20 early nodulin-like protein 20 (.1) AT3G01070 89 / 2e-22 AtENODL16 early nodulin-like protein 16 (.1) AT3G17675 82 / 2e-20 Cupredoxin superfamily protein (.1) AT2G32300 82 / 4e-19 UCC1 uclacyanin 1 (.1) AT3G27200 78 / 2e-18 Cupredoxin superfamily protein (.1) AT1G17800 75 / 2e-17 AtENODL22 early nodulin-like protein 22 (.1) AT2G25060 74 / 8e-17 AtENODL14 early nodulin-like protein 14 (.1) AT2G31050 72 / 6e-16 Cupredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G183300 [exp] 263 / 7e-91 AT5G15350 123 / 1e-35 early nodulin-like protein 17 (.1) Potri.017G088600 [exp] 102 / 7e-28 AT5G15350 194 / 5e-64 early nodulin-like protein 17 (.1) Potri.017G088500 [exp] 101 / 2e-27 AT2G27035 122 / 7e-36 early nodulin-like protein 20 (.1) Potri.001G219800 [exp] 99 / 4e-26 AT2G27035 130 / 1e-38 early nodulin-like protein 20 (.1) Potri.001G219900 [exp] 96 / 2e-25 AT2G27035 136 / 2e-41 early nodulin-like protein 20 (.1) Potri.009G136200 [exp] 89 / 7e-23 AT5G26330 88 / 4e-22 Cupredoxin superfamily protein (.1) Potri.004G121100 [exp] 87 / 7e-22 AT5G15350 149 / 4e-46 early nodulin-like protein 17 (.1) Potri.013G054500 [exp] 84 / 7e-21 AT3G17675 91 / 3e-24 Cupredoxin superfamily protein (.1) Potri.013G030000 [exp] 84 / 7e-21 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026064 [exp] 215 / 5e-72 AT5G15350 113 / 4e-32 early nodulin-like protein 17 (.1) Lus10014356 [exp] 205 / 4e-68 AT5G15350 108 / 2e-30 early nodulin-like protein 17 (.1) Lus10005231 [exp] 103 / 3e-28 AT5G15350 192 / 8e-63 early nodulin-like protein 17 (.1) Lus10030690 [exp] 103 / 4e-28 AT5G15350 190 / 4e-62 early nodulin-like protein 17 (.1) Lus10005229 [exp] 93 / 2e-24 AT2G27035 124 / 7e-37 early nodulin-like protein 20 (.1) Lus10026749 [exp] 86 / 3e-21 AT2G27035 135 / 7e-41 early nodulin-like protein 20 (.1) Lus10012165 [exp] 82 / 9e-20 AT5G07475 89 / 1e-22 Cupredoxin superfamily protein (.1) Lus10025536 [exp] 79 / 1e-18 AT2G27035 148 / 5e-46 early nodulin-like protein 20 (.1) Lus10002618 [exp] 76 / 4e-18 AT3G27200 89 / 2e-23 Cupredoxin superfamily protein (.1) Lus10007582 [exp] 81 / 5e-18 AT4G35110 120 / 2e-29 Arabidopsis phospholipase-like protein (PEARLI 4) family (.1), Arabidopsis phospholipase-like protein (PEARLI 4) family (.2), Arabidopsis phospholipase-like protein (PEARLI 4) family (.3), Arabidopsis phospholipase-like protein (PEARLI 4) family (.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.001G043600.3 pacid=42791809 polypeptide=Potri.001G043600.3.p locus=Potri.001G043600 ID=Potri.001G043600.3.v4.1 annot-version=v4.1 ATGGTGTCCAGCTCAGCTCGGCTCATCTTCTTTTGCTTCTTCATCCTCGTCTCCGCCATTGCTACCACCGCTACTGACCACATTGTTGGTGCTAATAAAG GCTGGAACCCTGGAATCAACTATACTCACTGGGCGAACAACCACACCTTCTATGTTGGTGACCTTATCTCTTTTAGGTACCAAAAGACACAGTACAATGT CTTTGAAGTGAACCAGACTGGTTATGACAACTGTACAACAGAAGGAGCAGTAGGCAACTGGACTAGTGGCAAAGATTTCATACCTCTTAACAAGGCCAAG AGATACTACTTCATTGGTGGGAATGGGCAGTGTTTCAATGGCATGAAGGTTACTATTCTTGTTCACCCTTTGCCACCACCACCAACATCGGCTACCATGG CTGCTAACGTGAAATCCTCAGATTCTGCAGCTCCATTGGTTTTCCATAAGGGGTTGGTGGGCTTGAGGGCTTTGGTTTTGGCAGTTGCTTCAATTTGGTT TGGATCTGGTTGGATCTAG
AA sequence Show only first row Show all	>Potri.001G043600.3 pacid=42791809 polypeptide=Potri.001G043600.3.p locus=Potri.001G043600 ID=Potri.001G043600.3.v4.1 annot-version=v4.1 MVSSSARLIFFCFFILVSAIATTATDHIVGANKGWNPGINYTHWANNHTFYVGDLISFRYQKTQYNVFEVNQTGYDNCTTEGAVGNWTSGKDFIPLNKAK RYYFIGGNGQCFNGMKVTILVHPLPPPPTSATMAANVKSSDSAAPLVFHKGLVGLRALVLAVASIWFGSGWI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G15350		AtENODL17	early nodulin-like protein 17 ...		Potri.001G043600 [exp]	0	1
AT3G17350			unknown protein		Potri.010G152900 [exp]	1.41	0.9454
AT5G64080		AtXYP1	xylogen protein 1, Bifunctiona...		Potri.003G020200 [exp]	3.00	0.9262
AT3G17350			unknown protein		Potri.008G099800 [exp]	3.74	0.9265
AT3G05030		ATNHX2, NHX2	sodium hydrogen exchanger 2 (....		Potri.010G031500 [exp]	4.00	0.9182	Pt-NHX1.1
AT2G39700		ATHEXPALPHA1.6,...	expansin A4 (.1)		Potri.001G240900 [exp]	5.47	0.9087	Pt-EXPA6.2
AT2G46890			Protein of unknown function (D...		Potri.014G109200 [exp]	5.47	0.9152
AT4G38660			Pathogenesis-related thaumatin...		Potri.009G132500 [exp]	5.91	0.9191
AT5G51560			Leucine-rich repeat protein ki...		Potri.012G128700 [exp]	6.32	0.9220
AT2G25270			unknown protein		Potri.018G023200 [exp]	7.34	0.9212
AT1G80690			PPPDE putative thiol peptidase...		Potri.001G047800 [exp]	7.48	0.9239

Compare expression of checked genes

Potri.001G043600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.