Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G07475 164 / 8e-52 Cupredoxin superfamily protein (.1) AT2G32300 110 / 1e-29 UCC1 uclacyanin 1 (.1) AT3G60270 96 / 4e-25 Cupredoxin superfamily protein (.1) AT3G27200 92 / 2e-23 Cupredoxin superfamily protein (.1) AT3G60280 88 / 1e-21 UCC3 uclacyanin 3 (.1) AT5G26330 85 / 1e-20 Cupredoxin superfamily protein (.1) AT1G72230 84 / 2e-20 Cupredoxin superfamily protein (.1) AT3G17675 81 / 5e-20 Cupredoxin superfamily protein (.1) AT2G26720 82 / 1e-19 Cupredoxin superfamily protein (.1) AT2G44790 81 / 3e-19 UCC2 uclacyanin 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G150300 [exp] 258 / 7e-89 AT5G07475 178 / 2e-57 Cupredoxin superfamily protein (.1) Potri.007G120200 [exp] 110 / 4e-30 AT2G32300 118 / 3e-32 uclacyanin 1 (.1) Potri.014G049600 [exp] 109 / 4e-30 AT3G60270 111 / 8e-31 Cupredoxin superfamily protein (.1) Potri.002G101300 [exp] 96 / 9e-25 AT1G72230 131 / 6e-39 Cupredoxin superfamily protein (.1) Potri.002G101200 [exp] 95 / 6e-24 AT1G72230 129 / 2e-37 Cupredoxin superfamily protein (.1) Potri.001G332200 [exp] 89 / 1e-22 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1) Potri.003G047300 [exp] 88 / 8e-22 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1) Potri.006G259000 [exp] 85 / 8e-21 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1) Potri.006G259101 [exp] 83 / 2e-20 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012085 [exp] 145 / 1e-44 AT5G07475 142 / 4e-43 Cupredoxin superfamily protein (.1) Lus10027143 [exp] 119 / 2e-33 AT2G32300 137 / 9e-40 uclacyanin 1 (.1) Lus10008720 [exp] 100 / 8e-27 AT1G72230 140 / 2e-42 Cupredoxin superfamily protein (.1) Lus10020944 [exp] 100 / 2e-26 AT1G72230 141 / 1e-42 Cupredoxin superfamily protein (.1) Lus10007401 [exp] 99 / 3e-24 AT1G51690 460 / 7e-159 protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform (.1.2.3) Lus10027043 [exp] 94 / 5e-24 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1) Lus10025580 [exp] 91 / 6e-23 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1) Lus10012165 [exp] 90 / 9e-23 AT5G07475 89 / 1e-22 Cupredoxin superfamily protein (.1) Lus10022350 [exp] 88 / 7e-22 AT3G27200 169 / 7e-54 Cupredoxin superfamily protein (.1) Lus10041570 [exp] 85 / 1e-20 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.001G080700.1 pacid=42789740 polypeptide=Potri.001G080700.1.p locus=Potri.001G080700 ID=Potri.001G080700.1.v4.1 annot-version=v4.1 ATGGCTAAGCTGGTTTTGGTCTATTCTCTGGTTGTTCTTGGCCTAGCATTAACATGCAATGCAGCAACTTACATGGTAGGTGATAACTCTGGCTGGGACA TAAGTACTGACCTTGATACATGGGCACAGAGCAAGACATTTGTCGTTGGGGATCTTCTATCGTTTCAATACTCATCATCCCACAGTCTTGAGGAGGTGAA GAAAGAAGATTTCGACAGCTGCAACACCACTAATGTTGCAAGAACATTCACAAATGGGAACACAACCGTGCCTTTGACAGAACCTGGGACGAGATACTTT GTTTGTGGTAACCAGTTACATTGTCTAGGAGGAATGAAGCTTCAGGTAAATGTAGAAGACAACCAAGCAAATCCACCGATTGGGGCGCCACAAGCACAGC CAGCAGGGGGTACTCTTACACAACCTTCTTCTAAGAGCAACAATCCTGCCTCTGTTATTCCAACTTCAGCGGGGTCTGTCTATGGGGGAAGGGATTGTAT TGTGATGGCTTTTCTTGGTTTTGTGGCTACCATGTTCTGGGTGGTGCGAGTTTGA
AA sequence Show only first row Show all	>Potri.001G080700.1 pacid=42789740 polypeptide=Potri.001G080700.1.p locus=Potri.001G080700 ID=Potri.001G080700.1.v4.1 annot-version=v4.1 MAKLVLVYSLVVLGLALTCNAATYMVGDNSGWDISTDLDTWAQSKTFVVGDLLSFQYSSSHSLEEVKKEDFDSCNTTNVARTFTNGNTTVPLTEPGTRYF VCGNQLHCLGGMKLQVNVEDNQANPPIGAPQAQPAGGTLTQPSSKSNNPASVIPTSAGSVYGGRDCIVMAFLGFVATMFWVVRV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G07475			Cupredoxin superfamily protein...		Potri.001G080700 [exp]	0	1
AT1G04520		PDLP2	plasmodesmata-located protein ...		Potri.013G048200 [exp]	5.09	0.9586
AT1G74460			GDSL-like Lipase/Acylhydrolase...		Potri.012G068700 [exp]	7.74	0.9543
AT2G39430			Disease resistance-responsive ...		Potri.008G049100 [exp]	9.00	0.9517
AT1G34670	MYB	ATMYB93	myb domain protein 93 (.1)		Potri.005G074500 [exp]	11.00	0.8911
AT3G18400	NAC	ANAC058	NAC domain containing protein ...		Potri.012G056300 [exp]	11.48	0.9495
AT5G06090		ATGPAT7, GPAT7	glycerol-3-phosphate acyltrans...		Potri.008G058200 [exp]	13.41	0.9493
AT3G24020			Disease resistance-responsive ...		Potri.001G054000 [exp]	14.69	0.9435
AT5G17430	AP2_ERF	BBM	BABY BOOM, Integrase-type DNA-...		Potri.010G181000 [exp]	15.65	0.9439
AT1G68850			Peroxidase superfamily protein...		Potri.008G110600 [exp]	16.61	0.9477
AT4G20390			Uncharacterised protein family...		Potri.011G154900 [exp]	17.86	0.9394

Compare expression of checked genes

Potri.001G080700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.