Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G64640 150 / 3e-46 AtENODL8 early nodulin-like protein 8 (.1) AT3G20570 91 / 5e-23 AtENODL9 early nodulin-like protein 9 (.1) AT1G48940 90 / 1e-22 AtENODL6 early nodulin-like protein 6 (.1) AT2G25060 89 / 3e-22 AtENODL14 early nodulin-like protein 14 (.1) AT3G18590 87 / 1e-21 AtENODL5 early nodulin-like protein 5 (.1) AT4G31840 86 / 6e-21 AtENODL15 early nodulin-like protein 15 (.1) AT4G28365 85 / 1e-20 AtENODL3 early nodulin-like protein 3 (.1) AT1G79800 85 / 1e-20 AtENODL7 early nodulin-like protein 7 (.1) AT4G32490 81 / 7e-19 AtENODL4 early nodulin-like protein 4 (.1) AT5G57920 80 / 7e-19 AtENODL10 early nodulin-like protein 10 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G018200 [exp] 91 / 7e-23 AT2G25060 177 / 7e-57 early nodulin-like protein 14 (.1) Potri.011G135400 [exp] 91 / 9e-23 AT3G20570 138 / 4e-41 early nodulin-like protein 9 (.1) Potri.006G264600 [exp] 90 / 1e-22 AT2G25060 184 / 9e-60 early nodulin-like protein 14 (.1) Potri.001G338800 [exp] 89 / 3e-22 AT5G14345 145 / 6e-45 early nodulin-like protein 21 (.1) Potri.015G052000 [exp] 87 / 2e-21 AT1G48940 163 / 1e-51 early nodulin-like protein 6 (.1) Potri.001G187700 [exp] 83 / 4e-20 AT1G79800 176 / 2e-56 early nodulin-like protein 7 (.1) Potri.006G184100 [exp] 82 / 1e-19 AT4G31840 174 / 5e-56 early nodulin-like protein 15 (.1) Potri.011G117800 [exp] 84 / 3e-19 AT5G53870 158 / 3e-45 early nodulin-like protein 1 (.1) Potri.017G011200 [exp] 79 / 4e-18 AT4G32490 157 / 2e-48 early nodulin-like protein 4 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033227 [exp] 223 / 2e-74 AT1G64640 169 / 1e-53 early nodulin-like protein 8 (.1) Lus10000336 [exp] 202 / 3e-65 AT1G64650 170 / 1e-52 Major facilitator superfamily protein (.1.2) Lus10022318 [exp] 90 / 1e-22 AT3G18590 146 / 4e-45 early nodulin-like protein 5 (.1) Lus10014880 [exp] 89 / 3e-22 AT3G18590 144 / 1e-43 early nodulin-like protein 5 (.1) Lus10003432 [exp] 89 / 6e-22 AT5G25090 167 / 5e-53 early nodulin-like protein 13 (.1) Lus10026880 [exp] 87 / 2e-21 AT5G25090 167 / 8e-53 early nodulin-like protein 13 (.1) Lus10043063 [exp] 83 / 1e-19 AT3G20570 153 / 4e-47 early nodulin-like protein 9 (.1) Lus10011158 [exp] 81 / 4e-19 AT3G20570 149 / 2e-45 early nodulin-like protein 9 (.1) Lus10032111 [exp] 78 / 4e-18 AT5G14345 147 / 1e-45 early nodulin-like protein 21 (.1) Lus10041211 [exp] 77 / 2e-17 AT5G26330 167 / 6e-53 Cupredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.001G085100.1 pacid=42789600 polypeptide=Potri.001G085100.1.p locus=Potri.001G085100 ID=Potri.001G085100.1.v4.1 annot-version=v4.1 ATGGTCAATCTTAGAAGTCCTAGATTCCTAGTCCTATATGCATTTCAGTTTCTTGTGCTGGTGCAAATCCAAGTCTCCTGTTACCAGTACAAGGTTGGAG ATTTAGATGCTTGGGGTATCCCTACTTCAGCAAATCCGCAAGTGTACACCTACTGGTCCAAATACCATACCTTGAAGATTGGGGATTCTCTCTTGTTCTT GTATCCACCAAGTCAAGATTCTGTGATTCAAGTCACACGAGAAAACTACAACTCCTGCAACCTGACAGATCCCATCTTGTACATGAACAATGGCAACTCT TTATTTAACATCACTGCATATGGGGACTTCTACTTCACGAGCGGAGTTCAAGGGCATTGTCAAAAGAAGCAGAAGCTACACATATCTGTGCCTGGCAATG GTTCAGCATCAGCATACTCTCCCTCTTATGGTCCTAGTGCATTGCCTGACTCCGCACCCTCTTACCCTACCGTGTTTGGCAGTATCCCATTACCACCTTC TTCTTCACCATTAAACAGATTTTCAATCTTGTTATCATTCATTATAGGAGCAGGTATTTGGGCAATAATCATGTGA
AA sequence Show only first row Show all	>Potri.001G085100.1 pacid=42789600 polypeptide=Potri.001G085100.1.p locus=Potri.001G085100 ID=Potri.001G085100.1.v4.1 annot-version=v4.1 MVNLRSPRFLVLYAFQFLVLVQIQVSCYQYKVGDLDAWGIPTSANPQVYTYWSKYHTLKIGDSLLFLYPPSQDSVIQVTRENYNSCNLTDPILYMNNGNS LFNITAYGDFYFTSGVQGHCQKKQKLHISVPGNGSASAYSPSYGPSALPDSAPSYPTVFGSIPLPPSSSPLNRFSILLSFIIGAGIWAIIM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G64640		AtENODL8	early nodulin-like protein 8 (...		Potri.001G085100 [exp]	0	1
AT4G30410			sequence-specific DNA binding ...		Potri.018G099100 [exp]	1.00	0.8748
AT1G77690		LAX3	like AUX1 3 (.1)		Potri.005G174000 [exp]	1.41	0.8685	PtrAUX7
AT2G40610		ATHEXPALPHA1.11...	expansin A8 (.1)		Potri.013G154700 [exp]	3.16	0.8220	Pt-EXP2.8,PtrEXPA2
AT3G12710			DNA glycosylase superfamily pr...		Potri.010G175300 [exp]	3.46	0.8319
AT4G30410			sequence-specific DNA binding ...		Potri.006G177000 [exp]	4.89	0.8422
AT3G57170			N-acetylglucosaminyl transfera...		Potri.006G044500 [exp]	5.47	0.7753
AT2G07560		AHA6	H\(+\)-ATPase 6, H\(+\)-ATPase...		Potri.001G048300 [exp]	6.32	0.7766	Pt-HA1.2
AT4G14750		IQD19	IQ-domain 19 (.1)		Potri.008G156700 [exp]	10.19	0.7510
AT1G21340	DOF	AtDof1,2	Dof-type zinc finger DNA-bindi...		Potri.005G188900 [exp]	14.49	0.7505
AT5G56540		ATAGP14, AGP14	arabinogalactan protein 14 (.1...		Potri.019G035500 [exp]	18.97	0.7760

Compare expression of checked genes

Potri.001G085100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.