Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G71450 184 / 8e-60 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G33760 146 / 7e-45 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G25810 113 / 2e-31 AP2_ERF TNY, TINY TINY, Integrase-type DNA-binding superfamily protein (.1) AT5G11590 111 / 1e-30 AP2_ERF DREB3, TINY2 TINY2, Integrase-type DNA-binding superfamily protein (.1) AT2G44940 112 / 2e-30 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G16750 106 / 3e-29 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G32800 107 / 4e-29 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT2G35700 103 / 4e-28 AP2_ERF ATERF38 ERF family protein 38 (.1) AT1G01250 103 / 4e-28 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT3G16280 103 / 1e-27 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G101100 [exp] 261 / 4e-90 AT1G71450 184 / 1e-59 Integrase-type DNA-binding superfamily protein (.1) Potri.019G075500 [exp] 238 / 2e-81 AT1G71450 200 / 5e-66 Integrase-type DNA-binding superfamily protein (.1) Potri.003G054100 [exp] 176 / 2e-56 AT1G71450 144 / 8e-44 Integrase-type DNA-binding superfamily protein (.1) Potri.019G075600 [exp] 176 / 2e-56 AT1G33760 147 / 6e-45 Integrase-type DNA-binding superfamily protein (.1) Potri.013G101200 [exp] 164 / 5e-52 AT1G33760 149 / 1e-45 Integrase-type DNA-binding superfamily protein (.1) Potri.014G099900 [exp] 111 / 7e-31 AT1G01250 191 / 4e-62 Integrase-type DNA-binding superfamily protein (.1) Potri.001G155700 [exp] 112 / 8e-31 AT2G44940 159 / 1e-47 Integrase-type DNA-binding superfamily protein (.1) Potri.003G079300 [exp] 111 / 8e-31 AT4G16750 150 / 7e-46 Integrase-type DNA-binding superfamily protein (.1) Potri.002G172200 [exp] 109 / 2e-30 AT1G01250 177 / 6e-57 Integrase-type DNA-binding superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041050 [exp] 160 / 2e-50 AT1G71450 189 / 1e-61 Integrase-type DNA-binding superfamily protein (.1) Lus10006173 [exp] 142 / 3e-43 AT1G71450 167 / 4e-53 Integrase-type DNA-binding superfamily protein (.1) Lus10041052 [exp] 132 / 9e-39 AT1G33760 143 / 3e-43 Integrase-type DNA-binding superfamily protein (.1) Lus10002953 [exp] 116 / 7e-33 AT1G33760 143 / 2e-43 Integrase-type DNA-binding superfamily protein (.1) Lus10003513 [exp] 110 / 9e-31 AT1G33760 140 / 2e-42 Integrase-type DNA-binding superfamily protein (.1) Lus10007799 [exp] 107 / 4e-30 AT2G44940 136 / 7e-42 Integrase-type DNA-binding superfamily protein (.1) Lus10004738 [exp] 108 / 7e-30 AT2G35700 144 / 7e-44 ERF family protein 38 (.1) Lus10034949 [exp] 110 / 2e-29 AT4G32800 169 / 3e-51 Integrase-type DNA-binding superfamily protein (.1) Lus10002801 [exp] 107 / 4e-29 AT5G11590 209 / 4e-68 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10043240 [exp] 107 / 6e-29 AT5G11590 176 / 1e-54 TINY2, Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [poplar] [flax] MBD-like PF00847 [poplar] [flax] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Potri.001G181500.1 pacid=42789769 polypeptide=Potri.001G181500.1.p locus=Potri.001G181500 ID=Potri.001G181500.1.v4.1 annot-version=v4.1 ATGGAAGGGAGGAATAGTACTGCTCACCATGGTGGTATAGCTTCTAGCTATACAGGAGTACGAAAGAGAAAATGGGGCAAATGGGTGTCGGAGATACGTG AACCTGAGAAGAAAACTAGAATTTGGTTAGGCAGTTTTGAGACACCAGAAATGGCAGCAGCTGCTTATGATGTTGCAGCTTTACATTTTAGGGGATGTGA AGCAAAACTTAATTTCCCTGAATTGGCTGGTAAGCTACCAATGCCAGCAAGCTCCAGTGCTGACCACATTCGCATGGCAGCTCATCAGGCAGCTGTTAGC CTTAGGCCCTCTACTGTTGACTCGTCCCAAGGTGGTAGCTCTAGCTCCAATGTCGGGCCTATCACGGTGAGGCTCTCGCCAAGCCAAATTCAGGCCATCC ATGAGTCACCATTGGATTCACCAAAGATGTGGATGCAAATGGCAGAGATAGCAACGCTAGAGGAGTCCTCCATGATGTTCTCTGATGACATTGAAGACGA CGAGTGGGATAACAACCAAACAGATTCTCTTTGGGGTCCTTAG
AA sequence Show only first row Show all	>Potri.001G181500.1 pacid=42789769 polypeptide=Potri.001G181500.1.p locus=Potri.001G181500 ID=Potri.001G181500.1.v4.1 annot-version=v4.1 MEGRNSTAHHGGIASSYTGVRKRKWGKWVSEIREPEKKTRIWLGSFETPEMAAAAYDVAALHFRGCEAKLNFPELAGKLPMPASSSADHIRMAAHQAAVS LRPSTVDSSQGGSSSSNVGPITVRLSPSQIQAIHESPLDSPKMWMQMAEIATLEESSMMFSDDIEDDEWDNNQTDSLWGP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G71450	AP2_ERF		Integrase-type DNA-binding sup...		Potri.001G181500 [exp]	0	1
AT3G06500		A/N-InvC	alkaline/neutral invertase C, ...		Potri.008G101500 [exp]	1.73	0.7871
AT1G08440			Aluminium activated malate tra...		Potri.009G017900 [exp]	4.00	0.7471
					Potri.001G022150 [exp]	7.74	0.7056
AT5G52020	AP2_ERF		Integrase-type DNA-binding sup...		Potri.001G110500 [exp]	8.06	0.7113	DREB65
AT2G43320			S-adenosyl-L-methionine-depend...		Potri.007G127300 [exp]	8.66	0.7354
AT5G52020	AP2_ERF		Integrase-type DNA-binding sup...		Potri.003G121200 [exp]	11.66	0.6962	DREB64
AT3G11760			unknown protein		Potri.018G027200 [exp]	13.71	0.7119
AT2G20562			unknown protein		Potri.011G114600 [exp]	17.32	0.6820
AT2G18420			Gibberellin-regulated family p...		Potri.002G022500 [exp]	18.76	0.6444
AT4G28400			Protein phosphatase 2C family ...		Potri.017G013300 [exp]	18.89	0.7017

Compare expression of checked genes

Potri.001G181500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.