Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-BABL.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02850 155 / 4e-50 ARPN plantacyanin (.1) AT1G17800 89 / 1e-23 AtENODL22 early nodulin-like protein 22 (.1) AT3G17675 81 / 5e-21 Cupredoxin superfamily protein (.1) AT2G32300 84 / 1e-20 UCC1 uclacyanin 1 (.1) AT5G26330 78 / 7e-19 Cupredoxin superfamily protein (.1) AT3G27200 77 / 1e-18 Cupredoxin superfamily protein (.1) AT2G44790 77 / 2e-18 UCC2 uclacyanin 2 (.1) AT3G60270 74 / 2e-17 Cupredoxin superfamily protein (.1) AT3G60280 73 / 9e-17 UCC3 uclacyanin 3 (.1) AT5G07475 72 / 1e-16 Cupredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G074000 [exp] 179 / 1e-59 AT2G02850 154 / 1e-49 plantacyanin (.1) Potri.002G241500 [exp] 133 / 2e-41 AT2G02850 122 / 8e-37 plantacyanin (.1) Potri.007G104600 [exp] 96 / 2e-26 AT1G17800 94 / 3e-25 early nodulin-like protein 22 (.1) Potri.003G047300 [exp] 93 / 2e-24 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1) Potri.008G151000 [exp] 92 / 3e-24 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1) Potri.010G089900 [exp] 92 / 3e-24 AT5G26330 187 / 7e-61 Cupredoxin superfamily protein (.1) Potri.002G161300 [exp] 82 / 1e-20 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1) Potri.013G030450 [exp] 82 / 2e-20 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1) Potri.013G030000 [exp] 82 / 2e-20 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018938 [exp] 158 / 5e-51 AT2G02850 151 / 2e-48 plantacyanin (.1) Lus10028640 [exp] 155 / 9e-50 AT2G02850 151 / 3e-48 plantacyanin (.1) Lus10028641 [exp] 155 / 9e-50 AT2G02850 151 / 3e-48 plantacyanin (.1) Lus10041848 [exp] 146 / 2e-46 AT2G02850 130 / 4e-40 plantacyanin (.1) Lus10041849 [exp] 143 / 2e-45 AT2G02850 130 / 5e-40 plantacyanin (.1) Lus10041850 [exp] 134 / 2e-41 AT2G02850 121 / 1e-36 plantacyanin (.1) Lus10022800 [exp] 109 / 9e-32 AT2G02850 100 / 4e-28 plantacyanin (.1) Lus10028396 [exp] 99 / 2e-27 AT2G02850 107 / 4e-31 plantacyanin (.1) Lus10028395 [exp] 97 / 4e-27 AT2G02850 107 / 2e-31 plantacyanin (.1) Lus10011867 [exp] 102 / 2e-26 AT3G07060 621 / 0.0 embryo defective 1974, NHL domain-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.001G209300.1 pacid=42791821 polypeptide=Potri.001G209300.1.p locus=Potri.001G209300 ID=Potri.001G209300.1.v4.1 annot-version=v4.1 ATGGTTCAGGGAAGAGGCAGTGCGATGGTGGCGACAGTCGCGGTTATGCTGTGCATGCTGCTGCTCCATTTTGATATGGCTCACGCAGCAACCTACACTG TTGGAGGCCCTGGTGGCTGGACCTTCAATGTTTCTGGCTGGCCTAAAGGAAAGAGTTTTAAAGCTGGTGATATACTTGTATTCAATTACAGCACTGCAGC CCACAATGTTGTTGCTGTGAACAAGGCTGGTTACAGTTCATGCACGAGCCCTAGAGGTGCCAAGGTTTACACATCAGGAAAGGATCAGATCAAGCTCGTG AAGGGACAAAATTTCTTCATCTGTAGCTTTGCTGGACACTGTCAGTCTGGAATGAAAATAGCTGTTAATGCTGCGTGA
AA sequence Show only first row Show all	>Potri.001G209300.1 pacid=42791821 polypeptide=Potri.001G209300.1.p locus=Potri.001G209300 ID=Potri.001G209300.1.v4.1 annot-version=v4.1 MVQGRGSAMVATVAVMLCMLLLHFDMAHAATYTVGGPGGWTFNVSGWPKGKSFKAGDILVFNYSTAAHNVVAVNKAGYSSCTSPRGAKVYTSGKDQIKLV KGQNFFICSFAGHCQSGMKIAVNAA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G02850		ARPN	plantacyanin (.1)		Potri.001G209300 [exp]	0	1	Pt-BABL.1
AT3G07230			wound-responsive protein-relat...		Potri.014G191300 [exp]	4.47	0.9312
AT2G25737			Sulfite exporter TauE/SafE fam...		Potri.018G037400 [exp]	5.47	0.9305
AT1G08390			unknown protein		Potri.004G190200 [exp]	8.24	0.8422
AT1G74520		ATHVA22A	HVA22 homologue A (.1)		Potri.012G069300 [exp]	11.22	0.8479	ATHVA22.1
					Potri.010G219950 [exp]	16.24	0.9059
AT1G62680			Pentatricopeptide repeat (PPR)...		Potri.019G099701 [exp]	17.66	0.9048
AT5G62850		ATVEX1, SWEET5,...	VEGETATIVE CELL EXPRESSED1, No...		Potri.015G074300 [exp]	23.15	0.7863
AT5G19650	OFP	ATOFP8, OFP8	ovate family protein 8 (.1)		Potri.006G156176 [exp]	24.00	0.8195
AT4G08330			unknown protein		Potri.005G178000 [exp]	28.72	0.7601
AT5G19760			Mitochondrial substrate carrie...		Potri.001G004366 [exp]	30.98	0.8912

Compare expression of checked genes

Potri.001G209300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.