Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27035 137 / 1e-41 AtENODL20 early nodulin-like protein 20 (.1) AT5G15350 113 / 3e-32 AtENODL17 early nodulin-like protein 17 (.1) AT4G12880 95 / 3e-25 AtENODL19 early nodulin-like protein 19 (.1.2) AT3G01070 74 / 9e-17 AtENODL16 early nodulin-like protein 16 (.1) AT2G25060 69 / 7e-15 AtENODL14 early nodulin-like protein 14 (.1) AT4G31840 64 / 5e-13 AtENODL15 early nodulin-like protein 15 (.1) AT3G27200 64 / 5e-13 Cupredoxin superfamily protein (.1) AT2G32300 61 / 2e-11 UCC1 uclacyanin 1 (.1) AT1G17800 57 / 1e-10 AtENODL22 early nodulin-like protein 22 (.1) AT5G26330 57 / 2e-10 Cupredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G219800 [exp] 147 / 4e-45 AT2G27035 130 / 1e-38 early nodulin-like protein 20 (.1) Potri.017G088500 [exp] 144 / 4e-44 AT2G27035 122 / 7e-36 early nodulin-like protein 20 (.1) Potri.017G088600 [exp] 106 / 2e-29 AT5G15350 194 / 5e-64 early nodulin-like protein 17 (.1) Potri.001G043600 [exp] 101 / 1e-27 AT5G15350 121 / 2e-35 early nodulin-like protein 17 (.1) Potri.003G183300 [exp] 99 / 4e-26 AT5G15350 123 / 1e-35 early nodulin-like protein 17 (.1) Potri.004G121100 [exp] 94 / 1e-24 AT5G15350 149 / 4e-46 early nodulin-like protein 17 (.1) Potri.006G259101 [exp] 67 / 3e-14 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1) Potri.002G161300 [exp] 65 / 2e-13 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1) Potri.009G136200 [exp] 64 / 3e-13 AT5G26330 88 / 4e-22 Cupredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026749 [exp] 151 / 5e-47 AT2G27035 135 / 7e-41 early nodulin-like protein 20 (.1) Lus10005229 [exp] 121 / 2e-35 AT2G27035 124 / 7e-37 early nodulin-like protein 20 (.1) Lus10025536 [exp] 115 / 1e-32 AT2G27035 148 / 5e-46 early nodulin-like protein 20 (.1) Lus10025535 [exp] 105 / 4e-27 AT5G19890 406 / 9e-141 Peroxidase superfamily protein (.1) Lus10030690 [exp] 91 / 5e-23 AT5G15350 190 / 4e-62 early nodulin-like protein 17 (.1) Lus10005231 [exp] 91 / 5e-23 AT5G15350 192 / 8e-63 early nodulin-like protein 17 (.1) Lus10014356 [exp] 89 / 1e-22 AT5G15350 108 / 2e-30 early nodulin-like protein 17 (.1) Lus10026064 [exp] 88 / 3e-22 AT5G15350 113 / 4e-32 early nodulin-like protein 17 (.1) Lus10012165 [exp] 68 / 1e-14 AT5G07475 89 / 1e-22 Cupredoxin superfamily protein (.1) Lus10007582 [exp] 68 / 1e-13 AT4G35110 120 / 2e-29 Arabidopsis phospholipase-like protein (PEARLI 4) family (.1), Arabidopsis phospholipase-like protein (PEARLI 4) family (.2), Arabidopsis phospholipase-like protein (PEARLI 4) family (.3), Arabidopsis phospholipase-like protein (PEARLI 4) family (.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.001G219900.1 pacid=42787628 polypeptide=Potri.001G219900.1.p locus=Potri.001G219900 ID=Potri.001G219900.1.v4.1 annot-version=v4.1 ATGGAAAGTTTAAGGAAAATGTTAGTAGTGCTGATGACGATGGTTGTCACAGTGCGTATGGTGAATGCTTCACTTGTTTATGTAGGAGGAGGGAAAGAAA CATGGAGATCTAACGTTAACTTCTCTGAATGGTCTGCACGTCAAAACATCTATGTGGGAGACTGGCTCTATTTTGGATTCGACAAGAAACTTTATAATGT TCTTGAGGTGAACAAGACAGGCTATGAAGGTTGCCACGACGTGGGCTTCATAAAGAATATCACAAGGGGAGGTCGAGATGTATTCCAAGTGAATGAGGCC AAGACATATTATTTCATTAATGGTGGTGGCAGTTGCTTTGGAGGAATGAAAGTTGCTGTCAATGTTGAAAATCCTCAGCCTGCCCCTTCCCCATCTCAAT TAACTGGTGTTAAAAGTATCAAAAATGGTTCTCCATCAAGATTTGGTGGCCATGTCGTTACCTTAATGGCTGTGCTTGCTAATGTTCTCTTGGCCTGGGC AATCCTTTAA
AA sequence Show only first row Show all	>Potri.001G219900.1 pacid=42787628 polypeptide=Potri.001G219900.1.p locus=Potri.001G219900 ID=Potri.001G219900.1.v4.1 annot-version=v4.1 MESLRKMLVVLMTMVVTVRMVNASLVYVGGGKETWRSNVNFSEWSARQNIYVGDWLYFGFDKKLYNVLEVNKTGYEGCHDVGFIKNITRGGRDVFQVNEA KTYYFINGGGSCFGGMKVAVNVENPQPAPSPSQLTGVKSIKNGSPSRFGGHVVTLMAVLANVLLAWAIL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G27035		AtENODL20	early nodulin-like protein 20 ...		Potri.001G219900 [exp]	0	1
AT5G60900		RLK1	receptor-like protein kinase 1...		Potri.001G014700 [exp]	12.84	0.6753
AT4G31500		SUR2, RNT1, RED...	SUPERROOT 2, RUNT 1, RED ELONG...		Potri.002G025350 [exp]	14.14	0.6516
AT1G20640		NLP4	Plant regulator RWP-RK family ...		Potri.002G009700 [exp]	14.49	0.7191
AT4G18170	WRKY	ATWRKY28, WRKY2...	WRKY DNA-binding protein 28 (....		Potri.002G059100 [exp]	19.79	0.6527
					Potri.010G074601 [exp]	35.72	0.6121

Compare expression of checked genes

Potri.001G219900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.