Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G29130 40 / 3e-05 LAC2, ATLAC2 laccase 2 (.1) AT2G38080 38 / 0.0002 ATLMCO4, IRX12, LAC4 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) AT5G58910 38 / 0.0003 LAC16 laccase 16 (.1) AT5G03260 37 / 0.0006 LAC11 laccase 11 (.1) AT5G60020 0 / 1 LAC17, ATLAC17 laccase 17 (.1) AT5G01190 0 / 1 LAC10 laccase 10 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G120200 [exp] 48 / 8e-08 AT5G60020 875 / 0.0 laccase 17 (.1) Potri.011G120300 [exp] 47 / 1e-07 AT5G60020 875 / 0.0 laccase 17 (.1) Potri.001G401300 [exp] 47 / 1e-07 AT5G60020 904 / 0.0 laccase 17 (.1) Potri.001G401100 [exp] 47 / 1e-07 AT5G60020 881 / 0.0 laccase 17 (.1) Potri.006G087500 [exp] 45 / 7e-07 AT5G60020 806 / 0.0 laccase 17 (.1) Potri.006G087100 [exp] 42 / 7e-06 AT5G60020 802 / 0.0 laccase 17 (.1) Potri.007G023300 [exp] 40 / 6e-05 AT5G03260 889 / 0.0 laccase 11 (.1) Potri.016G112100 [exp] 40 / 7e-05 AT2G38080 891 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) Potri.009G042500 [exp] 38 / 0.0003 AT2G38080 891 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019122 [exp] 48 / 7e-08 AT5G60020 938 / 0.0 laccase 17 (.1) Lus10024378 [exp] 48 / 9e-08 AT5G60020 853 / 0.0 laccase 17 (.1) Lus10034439 [exp] 48 / 9e-08 AT5G60020 943 / 0.0 laccase 17 (.1) Lus10010850 [exp] 48 / 1e-07 AT5G60020 856 / 0.0 laccase 17 (.1) Lus10034614 [exp] 47 / 1e-07 AT5G60020 934 / 0.0 laccase 17 (.1) Lus10004975 [exp] 43 / 6e-06 AT2G29130 244 / 1e-76 laccase 2 (.1) Lus10027782 [exp] 40 / 4e-05 AT2G38080 887 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) Lus10041481 [exp] 40 / 4e-05 AT2G38080 807 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) Lus10032894 [exp] 40 / 5e-05 AT2G38080 894 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1) Lus10034289 [exp] 40 / 5e-05 AT2G38080 795 / 0.0 LACCASE 4, IRREGULAR XYLEM 12, ARABIDOPSIS LACCASE-LIKE MULTICOPPER OXIDASE 4, Laccase/Diphenol oxidase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF07731 [poplar] [flax] Cu-oxidase_2 Multicopper oxidase
Representative CDS sequence Show only first row Show all	>Potri.001G243104.1 pacid=42789630 polypeptide=Potri.001G243104.1.p locus=Potri.001G243104 ID=Potri.001G243104.1.v4.1 annot-version=v4.1 ATGCAGAACACTAGCATTTTGGGTACTGAGAGTCACACTCTCCATCTTCATGGCCTCAATTTCTTTGTTGTTGGAGAAGGGTTTGGAAATTTTAATCCTA AGAATGATCCCAAAAATTTTAACCTTGTTGATCCTGTTGAGAGGAACACTGTTGGTGTGTGTGCCTTCTGGTGGTTGGGTGGCAATTCGATTTCGTGCAG ACAATCCAGATCAGCAGCAGTATGGAGAAGAAACCGTGCAAATTGGCATTGCTAA
AA sequence Show only first row Show all	>Potri.001G243104.1 pacid=42789630 polypeptide=Potri.001G243104.1.p locus=Potri.001G243104 ID=Potri.001G243104.1.v4.1 annot-version=v4.1 MQNTSILGTESHTLHLHGLNFFVVGEGFGNFNPKNDPKNFNLVDPVERNTVGVCAFWWLGGNSISCRQSRSAAVWRRNRANWHC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G60020		LAC17, ATLAC17	laccase 17 (.1)		Potri.001G243104 [exp]	0	1

Compare expression of checked genes

Potri.001G243104 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.