Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G65700 146 / 3e-47 Small nuclear ribonucleoprotein family protein (.1.2.3) AT1G19120 59 / 1e-12 Small nuclear ribonucleoprotein family protein (.1) AT3G14080 57 / 2e-11 Small nuclear ribonucleoprotein family protein (.1.2) AT2G03870 41 / 7e-06 EMB2816 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) AT3G11500 39 / 4e-05 Small nuclear ribonucleoprotein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G068400 [exp] 53 / 3e-10 AT3G14080 234 / 3e-81 Small nuclear ribonucleoprotein family protein (.1.2) Potri.001G166600 [exp] 53 / 5e-10 AT3G14080 233 / 9e-81 Small nuclear ribonucleoprotein family protein (.1.2) Potri.001G269500 [exp] 41 / 9e-06 AT2G03870 183 / 8e-62 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Potri.009G064000 [exp] 41 / 9e-06 AT2G03870 183 / 8e-62 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Potri.006G211100 [exp] 39 / 5e-05 AT3G11500 153 / 2e-50 Small nuclear ribonucleoprotein family protein (.1) Potri.016G078100 [exp] 38 / 9e-05 AT3G11500 152 / 5e-50 Small nuclear ribonucleoprotein family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042884 [exp] 137 / 2e-43 AT1G65700 158 / 7e-52 Small nuclear ribonucleoprotein family protein (.1.2.3) Lus10028183 [exp] 134 / 2e-42 AT1G65700 155 / 8e-51 Small nuclear ribonucleoprotein family protein (.1.2.3) Lus10008124 [exp] 55 / 1e-10 AT3G14080 236 / 3e-82 Small nuclear ribonucleoprotein family protein (.1.2) Lus10035639 [exp] 44 / 6e-07 AT2G03870 179 / 3e-60 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Lus10017019 [exp] 40 / 1e-05 AT3G11500 150 / 2e-49 Small nuclear ribonucleoprotein family protein (.1) Lus10021342 [exp] 39 / 4e-05 AT3G11500 152 / 3e-50 Small nuclear ribonucleoprotein family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [poplar] [flax] Sm-like PF01423 [poplar] [flax] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Potri.001G278000.1 pacid=42793717 polypeptide=Potri.001G278000.1.p locus=Potri.001G278000 ID=Potri.001G278000.1.v4.1 annot-version=v4.1 ATGTCTATTGGAACAGGACTCGAGTCTCTCGTAGATCAAACAATTTCAATTATCACAAATGACGGCCGGAATATAGTGGGAGTCTTAAAAGGCTTCGACC AGGCCACAAATATTATCCTTGATGAATCTCACGAGCGTGTTTACTCCACCAAGGAAGGTGTTCAACAACTAGTGTTGGGCTTGTACATAATAAGGGGTGA CAACATAGGCGTTGTTGGGGAACTTGATGAAGAGCTTGATGCGCACCTTGACTTGTCTAGTCTGAGAGCTCATCCACTCAAGCCTGTCATTCATTGA
AA sequence Show only first row Show all	>Potri.001G278000.1 pacid=42793717 polypeptide=Potri.001G278000.1.p locus=Potri.001G278000 ID=Potri.001G278000.1.v4.1 annot-version=v4.1 MSIGTGLESLVDQTISIITNDGRNIVGVLKGFDQATNIILDESHERVYSTKEGVQQLVLGLYIIRGDNIGVVGELDEELDAHLDLSSLRAHPLKPVIH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G65700			Small nuclear ribonucleoprotei...		Potri.001G278000 [exp]	0	1
AT5G10780			unknown protein		Potri.006G266300 [exp]	1.73	0.8101
AT2G03870		EMB2816	EMBRYO DEFECTIVE 2816, Small n...		Potri.001G269500 [exp]	2.00	0.7882
AT5G65430		14-3-3KAPPA, GF...	14-3-3 PROTEIN G-BOX FACTOR14 ...		Potri.005G157700 [exp]	4.47	0.7661	VF14.2
AT1G06760			winged-helix DNA-binding trans...		Potri.010G076800 [exp]	5.09	0.7309
AT5G04430		BTR1S, BTR1L, B...	BINDING TO TOMV RNA 1S \(SHORT...		Potri.010G230500 [exp]	6.00	0.7684
AT3G18940			clast3-related (.1)		Potri.004G148700 [exp]	7.00	0.7571
AT3G27430		PBB1	N-terminal nucleophile aminohy...		Potri.004G066000 [exp]	7.54	0.7690	Pt-PBB1.2
AT2G45640		ATSAP18, HDA19	SIN3 ASSOCIATED POLYPEPTIDE 18...		Potri.003G119300 [exp]	8.48	0.7164
AT5G19990		ATSUG1, RPT6A	regulatory particle triple-A A...		Potri.010G098300 [exp]	8.94	0.7101	A1.4
AT4G29040		RPT2A	regulatory particle AAA-ATPase...		Potri.002G252600 [exp]	9.16	0.7619	Pt-RPT2.2

Compare expression of checked genes

Potri.001G278000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.