Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G27200 172 / 3e-55 Cupredoxin superfamily protein (.1) AT2G32300 101 / 1e-26 UCC1 uclacyanin 1 (.1) AT5G07475 96 / 4e-25 Cupredoxin superfamily protein (.1) AT2G31050 88 / 4e-22 Cupredoxin superfamily protein (.1) AT3G17675 86 / 5e-22 Cupredoxin superfamily protein (.1) AT1G72230 87 / 9e-22 Cupredoxin superfamily protein (.1) AT2G26720 84 / 2e-20 Cupredoxin superfamily protein (.1) AT1G22480 82 / 5e-20 Cupredoxin superfamily protein (.1) AT1G45063 78 / 8e-18 copper ion binding;electron carriers (.1.2) AT5G26330 77 / 8e-18 Cupredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G101300 [exp] 99 / 4e-26 AT1G72230 131 / 6e-39 Cupredoxin superfamily protein (.1) Potri.013G030000 [exp] 97 / 5e-26 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1) Potri.007G120200 [exp] 99 / 1e-25 AT2G32300 118 / 3e-32 uclacyanin 1 (.1) Potri.013G030450 [exp] 97 / 1e-25 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1) Potri.002G101200 [exp] 98 / 2e-25 AT1G72230 129 / 2e-37 Cupredoxin superfamily protein (.1) Potri.003G117900 [exp] 95 / 6e-25 AT3G17675 108 / 6e-31 Cupredoxin superfamily protein (.1) Potri.013G061300 [exp] 91 / 1e-23 AT3G17675 102 / 1e-28 Cupredoxin superfamily protein (.1) Potri.003G150300 [exp] 91 / 4e-23 AT5G07475 178 / 2e-57 Cupredoxin superfamily protein (.1) Potri.003G047300 [exp] 88 / 6e-22 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041570 [exp] 191 / 8e-63 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1) Lus10022350 [exp] 186 / 8e-61 AT3G27200 169 / 7e-54 Cupredoxin superfamily protein (.1) Lus10020944 [exp] 105 / 6e-29 AT1G72230 141 / 1e-42 Cupredoxin superfamily protein (.1) Lus10008720 [exp] 103 / 3e-28 AT1G72230 140 / 2e-42 Cupredoxin superfamily protein (.1) Lus10027143 [exp] 101 / 6e-27 AT2G32300 137 / 9e-40 uclacyanin 1 (.1) Lus10027043 [exp] 95 / 1e-24 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1) Lus10002614 [exp] 89 / 7e-23 AT2G32300 100 / 1e-26 uclacyanin 1 (.1) Lus10025580 [exp] 90 / 8e-23 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1) Lus10002615 [exp] 85 / 2e-21 AT5G26330 96 / 9e-26 Cupredoxin superfamily protein (.1) Lus10022800 [exp] 84 / 2e-21 AT2G02850 100 / 4e-28 plantacyanin (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.001G332200.3 pacid=42788067 polypeptide=Potri.001G332200.3.p locus=Potri.001G332200 ID=Potri.001G332200.3.v4.1 annot-version=v4.1 ATGGAGTACAGAGTTTGTCTGGTGTTGGTTTTTGTTGCTTTGATCACCAAAGAAGCAATGGCAGCTCAACATGTTGTTGGGGGGAGCCAAGGTTGGGAAG AATCTACAGACTTCAGCTCATGGGCTTCAGGTCAAAAATTCAAGGTTGGAGATCAACTAGTTTTCAAGTACACATCAGGGCTGCACAGCGTGGTTGAACT TGGTGGCGAGAGTGCCTACAAGAGTTGTGGCCTTGGTACTGCGTTAAACTCAATGAATACTGGCAATGATGTTGTGAAACTGAACAAACCTGGAACACGT TACTTCGCCTGTGGTACTTTAGGCCACTGTGGCCAAGGCATGAAAGTGAAGATTACGGTAGAATCCGGGACTGCTCCGTCTACCCCAGAATCACCGTCTT CATCTTCATCTCCCGCAGCTTCCTCTGCATCCGCCATGCACAGTTATTTTGCTACATTTGTTCTTCTCACAGCGTTGGTGGCTACCAGTTTGTTATATAT GTTTTGA
AA sequence Show only first row Show all	>Potri.001G332200.3 pacid=42788067 polypeptide=Potri.001G332200.3.p locus=Potri.001G332200 ID=Potri.001G332200.3.v4.1 annot-version=v4.1 MEYRVCLVLVFVALITKEAMAAQHVVGGSQGWEESTDFSSWASGQKFKVGDQLVFKYTSGLHSVVELGGESAYKSCGLGTALNSMNTGNDVVKLNKPGTR YFACGTLGHCGQGMKVKITVESGTAPSTPESPSSSSSPAASSASAMHSYFATFVLLTALVATSLLYMF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G27200			Cupredoxin superfamily protein...		Potri.001G332200 [exp]	0	1
AT5G01930		MAN6, AtMAN6	endo-beta-mannase 6, Glycosyl ...		Potri.006G109900 [exp]	2.82	0.8821
AT3G51780		ATBAG4	BCL-2-associated athanogene 4 ...		Potri.001G279500 [exp]	4.00	0.8540
AT5G18460			Protein of Unknown Function (D...		Potri.013G050100 [exp]	4.89	0.8358
AT1G20850		XCP2	xylem cysteine peptidase 2 (.1...		Potri.005G256000 [exp]	7.74	0.8483	XCP2.1
					Potri.004G047866 [exp]	8.48	0.8298
AT5G61750			RmlC-like cupins superfamily p...		Potri.012G111500 [exp]	8.94	0.8479
AT3G21550		AtDMP2	Arabidopsis thaliana DUF679 do...		Potri.008G115100 [exp]	12.24	0.8238
AT1G54790			GDSL-like Lipase/Acylhydrolase...		Potri.002G216000 [exp]	15.49	0.8150
AT1G36980			unknown protein		Potri.002G089300 [exp]	16.09	0.7611
AT1G23460			Pectin lyase-like superfamily ...		Potri.001G463000 [exp]	19.36	0.7971

Compare expression of checked genes

Potri.001G332200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.