Potri.001G392300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G50940 223 / 2e-69 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT3G50930 221 / 2e-67 BCS1 cytochrome BC1 synthesis (.1)
AT5G17760 193 / 3e-57 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT2G18193 192 / 7e-57 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G17740 186 / 1e-54 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G17730 183 / 5e-54 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT3G28600 183 / 5e-54 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT3G28610 181 / 7e-53 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT3G28580 180 / 2e-52 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT2G18190 179 / 6e-52 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G020900 231 / 6e-72 AT3G50930 561 / 0.0 cytochrome BC1 synthesis (.1)
Potri.005G119900 223 / 8e-69 AT5G17760 512 / 3e-179 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.007G020800 222 / 3e-68 AT5G17760 506 / 1e-176 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.002G032700 207 / 3e-63 AT3G50930 437 / 1e-149 cytochrome BC1 synthesis (.1)
Potri.007G020500 205 / 2e-62 AT2G18193 511 / 1e-179 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.008G177200 203 / 2e-61 AT3G50940 401 / 4e-136 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.007G020600 201 / 3e-60 AT2G18193 553 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.007G012400 195 / 9e-59 AT3G50940 367 / 2e-123 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.011G111200 195 / 1e-58 AT3G50940 302 / 2e-98 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024275 207 / 1e-62 AT3G50940 434 / 2e-149 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10007391 202 / 8e-61 AT3G50940 424 / 2e-145 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10015802 195 / 2e-58 AT3G50940 462 / 9e-161 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10037004 193 / 9e-58 AT3G50930 457 / 9e-159 cytochrome BC1 synthesis (.1)
Lus10014284 193 / 2e-57 AT3G50930 535 / 0.0 cytochrome BC1 synthesis (.1)
Lus10032188 188 / 2e-55 AT5G40010 497 / 4e-173 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
Lus10014496 187 / 4e-55 AT5G40010 577 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
Lus10025989 175 / 1e-51 AT3G50930 445 / 1e-153 cytochrome BC1 synthesis (.1)
Lus10041918 175 / 5e-50 AT3G50930 383 / 2e-126 cytochrome BC1 synthesis (.1)
Lus10031318 167 / 2e-47 AT2G18193 415 / 1e-140 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00004 AAA ATPase family associated with various cellular activities (AAA)
CL0023 PF14363 AAA_assoc Domain associated at C-terminal with AAA
Representative CDS sequence
>Potri.001G392300.2 pacid=42791657 polypeptide=Potri.001G392300.2.p locus=Potri.001G392300 ID=Potri.001G392300.2.v4.1 annot-version=v4.1
ATGGTGTCTCTCCAGAACTTGCCTAATACAAAAACAGTTCTTTCTGTGGTAGCTTCTCTTGCAGCTTCAGCAGTGCTGATTCCAACAGCTGCCAATCTTC
GCATTTTTGCTCATCTTTTCCGTCCTCAATTCACTCTTGTTATAGAAGAATATGGACCGGATTACTTCTGTGATGAGTTGTTTTTGGCTGCTGAGACTTA
TCTGGGAACTAAATCGGCTCCATCAATTCGAAGAATAAAGGCATGCAAGAAGGAGAAAGAGAAAAAACCAGCGATTTCCCTGGACAGAGACCAAGAAATT
CTTGATGTTTTTGAAAATATTGAAGTAAAGTGGAGGATGGTTATTAGAGAAAACTCTGAGGTTAGAAATTATACCTTAGTAGCACGACTAAGATCCTATG
AGCTGGTTTTTCACAAGAAGCACAAAGAGAAGGTCCTGGGTTCTTACCTGCCGTTCATTTTACGGCAGGCGAAGGCCATTCAAGAGGAAAACAAGGTAAG
ACAGCTCAACAGTCTTGGAGGTTTATCTTGGTTAACATCAACCATAATAGATCATCCGATGACCTTTGAGACCATTGCAATGGATGAGAGGCTCAAGGAA
GAAATAATAGGTGATCTGAACACCTTCGTGAAGTCAAAGGAGTACTACAGAAAAATCGGGAAAGCTCGGAAACGTGGATACCTGATACACGGTCCTCCTG
GAACAGGAAAGTCGAGCTTGATCGCCGCCATGGCTAATCACTTGAACTACAGTATCCATGACTTGGATCTACAGGATGATAATTTCCTTACAAGTTACGA
TATTAGGTCAGTGTTGCTTCACCATTTAGACAAAACTATACTTGTCATCAAAGATATTGATTCCACTGTCACAGTATCATGCCGAAGGCGGAGATTTGAG
CCAAGGAAGGTGGTTGAGGTTCAAAAACAGGCTATGCTCTTAAGGCTACTGCAGTTTATTGATGGACTTTTGGCTGCCTCGCATCAATGA
AA sequence
>Potri.001G392300.2 pacid=42791657 polypeptide=Potri.001G392300.2.p locus=Potri.001G392300 ID=Potri.001G392300.2.v4.1 annot-version=v4.1
MVSLQNLPNTKTVLSVVASLAASAVLIPTAANLRIFAHLFRPQFTLVIEEYGPDYFCDELFLAAETYLGTKSAPSIRRIKACKKEKEKKPAISLDRDQEI
LDVFENIEVKWRMVIRENSEVRNYTLVARLRSYELVFHKKHKEKVLGSYLPFILRQAKAIQEENKVRQLNSLGGLSWLTSTIIDHPMTFETIAMDERLKE
EIIGDLNTFVKSKEYYRKIGKARKRGYLIHGPPGTGKSSLIAAMANHLNYSIHDLDLQDDNFLTSYDIRSVLLHHLDKTILVIKDIDSTVTVSCRRRRFE
PRKVVEVQKQAMLLRLLQFIDGLLAASHQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G50940 P-loop containing nucleoside t... Potri.001G392300 0 1
AT1G74875 unknown protein Potri.013G008800 11.57 0.9246
AT3G04120 GAPC1, GAPC-1, ... glyceraldehyde-3-phosphate deh... Potri.001G335800 15.42 0.9244 GAPDH.2
Potri.002G099150 20.04 0.9242
AT5G47540 Mo25 family protein (.1) Potri.003G055900 22.97 0.9242
Potri.006G062050 34.72 0.9240
AT5G05800 unknown protein Potri.008G217500 38.39 0.9240
Potri.012G082350 44.83 0.9240
AT1G06280 AS2 LBD2 LOB domain-containing protein ... Potri.013G123900 46.30 0.9240
AT2G40730 CTEXP cytoplasmic tRNA export protei... Potri.019G059200 51.96 0.7153
AT3G19090 RNA-binding protein (.1) Potri.004G144700 53.75 0.8176

Potri.001G392300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.