Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61310 69 / 4e-13 LRR and NB-ARC domains-containing disease resistance protein (.1) AT5G05400 65 / 8e-12 LRR and NB-ARC domains-containing disease resistance protein (.1) AT1G61190 63 / 2e-11 LRR and NB-ARC domains-containing disease resistance protein (.1) AT1G61180 62 / 8e-11 LRR and NB-ARC domains-containing disease resistance protein (.1.2) AT1G12210 60 / 3e-10 RFL1 RPS5-like 1 (.1) AT1G63350 59 / 6e-10 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G61300 59 / 7e-10 LRR and NB-ARC domains-containing disease resistance protein (.1) AT1G51480 57 / 2e-09 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G12290 57 / 3e-09 Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2) AT5G43740 56 / 6e-09 Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G426030 [exp] 481 / 2e-165 AT1G61310 114 / 1e-25 LRR and NB-ARC domains-containing disease resistance protein (.1) Potri.001G433700 [exp] 410 / 9e-141 AT4G27190 243 / 7e-69 NB-ARC domain-containing disease resistance protein (.1) Potri.001G432366 [exp] 403 / 2e-139 AT4G27190 231 / 1e-65 NB-ARC domain-containing disease resistance protein (.1) Potri.001G435100 [exp] 380 / 8e-132 AT4G27190 223 / 2e-63 NB-ARC domain-containing disease resistance protein (.1) Potri.001G426430 [exp] 399 / 8e-131 AT4G27190 276 / 4e-77 NB-ARC domain-containing disease resistance protein (.1) Potri.001G426660 [exp] 395 / 1e-130 AT4G27220 238 / 3e-65 NB-ARC domain-containing disease resistance protein (.1) Potri.001G426200 [exp] 391 / 2e-126 AT4G27190 288 / 1e-80 NB-ARC domain-containing disease resistance protein (.1) Potri.001G434000 [exp] 391 / 2e-126 AT4G27190 271 / 3e-75 NB-ARC domain-containing disease resistance protein (.1) Potri.001G433466 [exp] 389 / 4e-126 AT4G27190 261 / 1e-71 NB-ARC domain-containing disease resistance protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020533 [exp] 45 / 3e-05 AT1G27170 405 / 1e-122 transmembrane receptors;ATP binding (.1.2) Lus10008221 [exp] 42 / 0.0004 AT4G12010 400 / 8e-120 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10006789 [exp] 42 / 0.0004 AT4G12010 325 / 7e-96 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10002247 [exp] 42 / 0.0005 AT5G36930 363 / 1e-108 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10007828 [exp] 42 / 0.0005 AT5G36930 319 / 7e-92 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10007790 [exp] 41 / 0.0005 AT5G36930 343 / 4e-99 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10004257 [exp] 41 / 0.0006 AT5G36930 446 / 7e-136 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10023051 [exp] 41 / 0.0007 AT4G12010 415 / 2e-125 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10042165 [exp] 41 / 0.0008 AT5G36930 326 / 9e-94 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10016029 [exp] 41 / 0.0008 AT4G12010 451 / 2e-138 Disease resistance protein (TIR-NBS-LRR class) family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00931 [poplar] [flax] NB-ARC NB-ARC domain
Representative CDS sequence Show only first row Show all	>Potri.001G427670.1 pacid=42792063 polypeptide=Potri.001G427670.1.p locus=Potri.001G427670 ID=Potri.001G427670.1.v4.1 annot-version=v4.1 ATGGCTCTCGAAAGTGCTGGTGGATCCATTATAGCTATGCTAGCAGAACTCATGGTGGAACCAGTAGGAAGGCAGTTCCGTTACATGTTCTGTTTCAACA ATTTTGCTCAAGAATTCAAAGAACAAAAGGAGAACCTGGTTTCGGCAAAAGAACGTCTGCAAGACGATGTCGAAGCTGCTGAAAGGAATGCTGAAAAAAC TTACAAAGATGTCAAAAAGTGGCTGGAAGATGCAAACAACCAAATTGAAGGTGCGAAGCCCTTGGAAAATGAAATAGGAAAAAACGGCAAATGCTTTACT TGGTGCCCAAACTGCATGCGACAATTCAAGTTAAGCAAGGCACTGGCCAAGAAGTCGGAGACTTTCAGAAAAATTCTAGAAAATAGCACAAAGTTTAAAA CAGTGGCCCAAAAAGCTCCTCCTCAGCCCATAGAATTTCTAACATCAAAGGAATTCACGCCCTCAGAATCGTCAAAAGAAGCTTTGGAACAGATCATGAA AGCTCTCAAAGATGACACCGTCAATATGATCGGACTGTACGGCATGGGAGGGGTGGGTAAAACAACCCTGGTGAAAGAAGTAGGCAGGAGAGCCAAAGAG TCGCAGCTTTTTCCTGACGTTTTGATGGCTACGGTGTCCCAGAATCCAAATTTCATAGGCATCCAGGATCGAATGGCAGATAGTTTACATCTGAAATTTG AAAAAAACGAGTAA
AA sequence Show only first row Show all	>Potri.001G427670.1 pacid=42792063 polypeptide=Potri.001G427670.1.p locus=Potri.001G427670 ID=Potri.001G427670.1.v4.1 annot-version=v4.1 MALESAGGSIIAMLAELMVEPVGRQFRYMFCFNNFAQEFKEQKENLVSAKERLQDDVEAAERNAEKTYKDVKKWLEDANNQIEGAKPLENEIGKNGKCFT WCPNCMRQFKLSKALAKKSETFRKILENSTKFKTVAQKAPPQPIEFLTSKEFTPSESSKEALEQIMKALKDDTVNMIGLYGMGGVGKTTLVKEVGRRAKE SQLFPDVLMATVSQNPNFIGIQDRMADSLHLKFEKNE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G61310			LRR and NB-ARC domains-contain...		Potri.001G427670 [exp]	0	1
AT1G61310			LRR and NB-ARC domains-contain...		Potri.001G426030 [exp]	1.73	0.9703
AT4G27220			NB-ARC domain-containing disea...		Potri.001G427440 [exp]	4.69	0.8827
AT2G33770		ATUBC24, UBC24,...	UBIQUITIN-CONJUGATING ENZYME 2...		Potri.011G052600 [exp]	4.89	0.8965
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Potri.006G023600 [exp]	5.09	0.8745
AT1G80490		TPR1	TOPLESS-related 1 (.1.2)		Potri.018G023900 [exp]	5.65	0.8695
AT1G79740			hAT transposon superfamily (.1...		Potri.018G135702 [exp]	6.00	0.8747
AT4G23980	ARF	ARF9	auxin response factor 9 (.1.2)		Potri.001G088600 [exp]	6.32	0.8871
AT1G67710	GARP	ARR11	response regulator 11 (.1)		Potri.010G053100 [exp]	11.31	0.8512
AT1G21980		ATPIPK1, ATPIP5...	phosphatidylinositol-4-phospha...		Potri.019G015768 [exp]	13.74	0.8553
AT1G80490		TPR1	TOPLESS-related 1 (.1.2)		Potri.018G023800 [exp]	14.38	0.8569

Compare expression of checked genes

Potri.001G427670 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.