Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G43740 96 / 2e-23 Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2) AT5G43730 96 / 4e-23 Disease resistance protein (CC-NBS-LRR class) family (.1) AT4G27190 94 / 9e-23 NB-ARC domain-containing disease resistance protein (.1) AT5G63020 94 / 1e-22 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G61300 93 / 3e-22 LRR and NB-ARC domains-containing disease resistance protein (.1) AT1G61310 92 / 6e-22 LRR and NB-ARC domains-containing disease resistance protein (.1) AT1G61190 91 / 2e-21 LRR and NB-ARC domains-containing disease resistance protein (.1) AT1G61180 91 / 2e-21 LRR and NB-ARC domains-containing disease resistance protein (.1.2) AT1G63350 89 / 8e-21 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G51480 87 / 5e-20 Disease resistance protein (CC-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G426200 [exp] 306 / 8e-97 AT4G27190 288 / 1e-80 NB-ARC domain-containing disease resistance protein (.1) Potri.001G426430 [exp] 290 / 9e-92 AT4G27190 276 / 4e-77 NB-ARC domain-containing disease resistance protein (.1) Potri.001G434000 [exp] 281 / 3e-88 AT4G27190 271 / 3e-75 NB-ARC domain-containing disease resistance protein (.1) Potri.001G433700 [exp] 264 / 3e-85 AT4G27190 243 / 7e-69 NB-ARC domain-containing disease resistance protein (.1) Potri.001G435100 [exp] 257 / 2e-84 AT4G27190 223 / 2e-63 NB-ARC domain-containing disease resistance protein (.1) Potri.001G423925 [exp] 255 / 2e-84 AT4G27190 219 / 1e-62 NB-ARC domain-containing disease resistance protein (.1) Potri.001G432366 [exp] 258 / 4e-84 AT4G27190 231 / 1e-65 NB-ARC domain-containing disease resistance protein (.1) Potri.001G432680 [exp] 251 / 4e-83 AT4G27190 179 / 5e-49 NB-ARC domain-containing disease resistance protein (.1) Potri.001G446966 [exp] 250 / 2e-82 AT4G27190 166 / 4e-44 NB-ARC domain-containing disease resistance protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020533 [exp] 62 / 1e-11 AT1G27170 405 / 1e-122 transmembrane receptors;ATP binding (.1.2) Lus10039540 [exp] 59 / 2e-10 AT3G14470 727 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Lus10039509 [exp] 59 / 3e-10 AT3G14460 613 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10026109 [exp] 56 / 2e-09 AT3G14470 598 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Lus10026132 [exp] 55 / 6e-09 AT3G14460 594 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10020536 [exp] 54 / 2e-08 AT1G27170 392 / 8e-118 transmembrane receptors;ATP binding (.1.2) Lus10020537 [exp] 52 / 8e-08 AT1G27170 404 / 6e-121 transmembrane receptors;ATP binding (.1.2) Lus10020534 [exp] 51 / 8e-08 AT5G36930 414 / 1e-124 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10021769 [exp] 51 / 9e-08 AT4G33300 583 / 0.0 ADR1-like 1 (.1.2) Lus10026961 [exp] 51 / 1e-07 AT5G36930 420 / 2e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00931 [poplar] [flax] NB-ARC NB-ARC domain
Representative CDS sequence Show only first row Show all	>Potri.001G432200.2 pacid=42788673 polypeptide=Potri.001G432200.2.p locus=Potri.001G432200 ID=Potri.001G432200.2.v4.1 annot-version=v4.1 ATGCCCTCAGAATCATCAAAAGAAGCTTTGGAACAGATCATGAAAGCTCTCAAAGATGACAACGTCAATATGATTGGACCGTATGGCATGGGAGGGGTGG GTAAAACCACCCTGGTAAAAGAAGTAGGCAGGAGAGCCAAAGAGTTGCAGCTTTTTCCTGAAGTTTTGATGCCTACGGTGTCCCGGAATCCAAATGTCAC AGACATCCAGGATCAAATGGCAGATAAGTTACGTCTGGATATTAAAGAAAATAGCAGAGAAGGGAGAGCAGATCGATTAAGGCATAGACTGAAGGAAGTG GAGAAGATGCTTATAATCCTAGATGATGTTTGGAAAAATATTGACTTGAAAGAGATATGGATCCCATTTGGTGATTATCACAGGGGTTGTAAAATTCTTC TAACAACATGTCCTCCAGGCATATGTTCTTCTATGGAGTGCCAGCAAAAAGTGTTTTTAAGAGTCTTATCTAAAGATGAAGCATTGGTTTTATTCAGAAT CAATGCAGGTTATACGTGA
AA sequence Show only first row Show all	>Potri.001G432200.2 pacid=42788673 polypeptide=Potri.001G432200.2.p locus=Potri.001G432200 ID=Potri.001G432200.2.v4.1 annot-version=v4.1 MPSESSKEALEQIMKALKDDNVNMIGPYGMGGVGKTTLVKEVGRRAKELQLFPEVLMPTVSRNPNVTDIQDQMADKLRLDIKENSREGRADRLRHRLKEV EKMLIILDDVWKNIDLKEIWIPFGDYHRGCKILLTTCPPGICSSMECQQKVFLRVLSKDEALVLFRINAGYT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G43740			Disease resistance protein (CC...		Potri.001G432200 [exp]	0	1
AT4G00450		CCT, CRP	CRYPTIC PRECOCIOUS, CENTER CIT...		Potri.002G159900 [exp]	4.47	0.9091	Pt-CRP.3
					Potri.017G015167 [exp]	6.92	0.8173
AT1G27700			Syntaxin/t-SNARE family protei...		Potri.004G090200 [exp]	7.21	0.8789
AT1G79350		EMB1135	embryo defective 1135, RING/FY...		Potri.008G081200 [exp]	9.79	0.8566
AT5G01110			Tetratricopeptide repeat (TPR)...		Potri.001G276500 [exp]	13.00	0.8560
AT4G20060		EMB1895	EMBRYO DEFECTIVE 1895, ARM rep...		Potri.018G118800 [exp]	14.45	0.8571
AT4G29410			Ribosomal L28e protein family ...		Potri.006G212501 [exp]	14.83	0.8130
AT3G62900			CW-type Zinc Finger (.1)		Potri.005G028700 [exp]	15.96	0.8519
AT5G04290		SPT5L, KTF1	SPT5-LIKE, kow domain-containi...		Potri.010G228766 [exp]	16.43	0.8652
AT2G40770			zinc ion binding;DNA binding;h...		Potri.019G060900 [exp]	17.49	0.8729

Compare expression of checked genes

Potri.001G432200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.