Potri.001G440100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G20440 211 / 1e-67 SMB small nuclear ribonucleoprotein associated protein B (.1.2.3.4)
AT5G44500 204 / 7e-65 Small nuclear ribonucleoprotein family protein (.1.2)
AT1G76860 45 / 3e-06 Small nuclear ribonucleoprotein family protein (.1)
AT1G21190 45 / 5e-06 Small nuclear ribonucleoprotein family protein (.1)
AT3G62840 40 / 0.0003 Small nuclear ribonucleoprotein family protein (.1.2)
AT2G47640 40 / 0.0003 Small nuclear ribonucleoprotein family protein (.1.2.3.4)
AT3G11500 39 / 0.0003 Small nuclear ribonucleoprotein family protein (.1)
AT3G14080 39 / 0.001 Small nuclear ribonucleoprotein family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G155700 235 / 1e-76 AT4G20440 218 / 2e-70 small nuclear ribonucleoprotein associated protein B (.1.2.3.4)
Potri.005G191600 45 / 2e-06 AT1G76860 176 / 3e-59 Small nuclear ribonucleoprotein family protein (.1)
Potri.002G068800 45 / 3e-06 AT1G76860 175 / 1e-58 Small nuclear ribonucleoprotein family protein (.1)
Potri.006G211100 41 / 5e-05 AT3G11500 153 / 2e-50 Small nuclear ribonucleoprotein family protein (.1)
Potri.014G129100 42 / 6e-05 AT3G62840 204 / 6e-70 Small nuclear ribonucleoprotein family protein (.1.2)
Potri.002G204300 42 / 6e-05 AT3G62840 204 / 6e-70 Small nuclear ribonucleoprotein family protein (.1.2)
Potri.018G096200 41 / 6e-05 AT4G30330 166 / 3e-55 Small nuclear ribonucleoprotein family protein (.1)
Potri.006G174000 41 / 6e-05 AT4G30330 166 / 3e-55 Small nuclear ribonucleoprotein family protein (.1)
Potri.016G078100 39 / 0.0002 AT3G11500 152 / 5e-50 Small nuclear ribonucleoprotein family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013108 230 / 4e-75 AT5G44500 269 / 5e-91 Small nuclear ribonucleoprotein family protein (.1.2)
Lus10038421 225 / 5e-73 AT5G44500 263 / 2e-88 Small nuclear ribonucleoprotein family protein (.1.2)
Lus10023386 220 / 3e-71 AT5G44500 259 / 5e-87 Small nuclear ribonucleoprotein family protein (.1.2)
Lus10003498 79 / 3e-17 AT5G44500 81 / 1e-18 Small nuclear ribonucleoprotein family protein (.1.2)
Lus10030367 42 / 5e-05 AT2G47640 185 / 2e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4)
Lus10007876 42 / 5e-05 AT2G47640 185 / 2e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4)
Lus10026556 42 / 5e-05 AT2G47640 184 / 3e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4)
Lus10013840 42 / 5e-05 AT2G47640 184 / 3e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4)
Lus10021342 41 / 7e-05 AT3G11500 152 / 3e-50 Small nuclear ribonucleoprotein family protein (.1)
Lus10026326 41 / 8e-05 AT1G76860 176 / 4e-59 Small nuclear ribonucleoprotein family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0527 Sm-like PF01423 LSM LSM domain
Representative CDS sequence
>Potri.001G440100.2 pacid=42793219 polypeptide=Potri.001G440100.2.p locus=Potri.001G440100 ID=Potri.001G440100.2.v4.1 annot-version=v4.1
ATGTCGATGTCAAAGAGCTCTAAGATGCTCCAATACATAAACTACCGGATGCGTGTGACCATCCAAGATGGTCGGCAGCTGGTAGGGAAATTCATGGCCT
TTGATCGCCACATGAACCTTGTACTTGGTGATTGCGAGGAGTTCCGCAAGCTCCCACCAGCAAAGGGCAAGAAGAACAATGAAGAGCGTGAGGACCGCCG
AACACTTGGCCTTGTTCTTCTTCGTGGTGAAGAGGTCATCTCTATGACTGTTGAGGGCCCTCCTCCTCCTGAAGAGTCTCGCGCCAAGGCTGTCTCTGCC
GCAGCTGCTTCTGGTCCTGGTCTTGGTCGTGCTGCTGGCCGCGGAATTCCCACTGCTCCTCTTATTCAAGCCCAGCCTGGCCTTGCAGGTCCTGTTCGTG
GTGTGGGTGGGCCTTCACCTGGCATGATGCAGCCACAATTCATGCGCCCCCCAGTCCCACAGCATTCTGCTCCACCCATGACTTACCCTGCATCAAGTGC
TCCACCACCTGGTGGTGCACCTGTGGTCCGACCACCTGGCCAGATGCCTCCTGGACCATATCCTGGTCAGGGTCCACCAATGGGTCGGGGTCCACCACCA
CCAGGTCCACTACAATTTTCTGCTAGGCCCCCCCAGGGTTTCCCAATGCCACCACAGTTTGCCCAGAGACCTATGGGAATGCCACCCCAGGGACAGGCAC
CAATGATGAGAGGACCACCTGCTCCACCAAGACCTGGAATGCCAGCACCACCTCCACCCCGTCCTGGGATGCCACCTCCACCTGGTGGTCATGTTCCTGT
TTTTGGACCACCTCGTCCGGGAATGCCGCCACCTCCCAATGCCCAACAGCAGCAGAATCAGCAACAATAG
AA sequence
>Potri.001G440100.2 pacid=42793219 polypeptide=Potri.001G440100.2.p locus=Potri.001G440100 ID=Potri.001G440100.2.v4.1 annot-version=v4.1
MSMSKSSKMLQYINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKNNEEREDRRTLGLVLLRGEEVISMTVEGPPPPEESRAKAVSA
AAASGPGLGRAAGRGIPTAPLIQAQPGLAGPVRGVGGPSPGMMQPQFMRPPVPQHSAPPMTYPASSAPPPGGAPVVRPPGQMPPGPYPGQGPPMGRGPPP
PGPLQFSARPPQGFPMPPQFAQRPMGMPPQGQAPMMRGPPAPPRPGMPAPPPPRPGMPPPPGGHVPVFGPPRPGMPPPPNAQQQQNQQQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G20440 SMB small nuclear ribonucleoprotei... Potri.001G440100 0 1
AT4G39300 unknown protein Potri.004G154800 2.44 0.8468
AT2G39795 Mitochondrial glycoprotein fam... Potri.010G198600 2.82 0.8531
AT5G64670 Ribosomal protein L18e/L15 sup... Potri.001G324300 3.00 0.8773
AT2G35790 unknown protein Potri.010G219400 4.89 0.8420
AT1G14620 XTR2, EXGT-A2, ... decoy (.1.2) Potri.002G164800 7.00 0.8349
AT5G22100 RNA cyclase family protein (.1... Potri.009G016000 7.74 0.8369
AT5G11630 unknown protein Potri.006G237800 8.94 0.8377
AT5G59240 Ribosomal protein S8e family p... Potri.001G360500 12.72 0.7537
AT3G06610 DNA-binding enhancer protein-r... Potri.008G105000 14.28 0.8178
AT1G18800 NRP2 NAP1-related protein 2 (.1) Potri.017G080700 15.19 0.7912

Potri.001G440100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.