Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61310 86 / 5e-20 LRR and NB-ARC domains-containing disease resistance protein (.1) AT1G61180 84 / 2e-19 LRR and NB-ARC domains-containing disease resistance protein (.1.2) AT5G63020 84 / 4e-19 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G61190 83 / 7e-19 LRR and NB-ARC domains-containing disease resistance protein (.1) AT1G61300 82 / 9e-19 LRR and NB-ARC domains-containing disease resistance protein (.1) AT4G27190 82 / 1e-18 NB-ARC domain-containing disease resistance protein (.1) AT4G27220 81 / 4e-18 NB-ARC domain-containing disease resistance protein (.1) AT5G43740 80 / 7e-18 Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2) AT1G51480 79 / 1e-17 Disease resistance protein (CC-NBS-LRR class) family (.1) AT4G26090 79 / 2e-17 RPS2 RESISTANT TO P. SYRINGAE 2, NB-ARC domain-containing disease resistance protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G444050 [exp] 277 / 8e-87 AT4G27220 261 / 4e-72 NB-ARC domain-containing disease resistance protein (.1) Potri.001G446966 [exp] 228 / 1e-73 AT4G27190 166 / 4e-44 NB-ARC domain-containing disease resistance protein (.1) Potri.001G446016 [exp] 234 / 2e-72 AT4G27190 281 / 4e-80 NB-ARC domain-containing disease resistance protein (.1) Potri.001G419800 [exp] 234 / 8e-72 AT4G27190 253 / 4e-69 NB-ARC domain-containing disease resistance protein (.1) Potri.001G443400 [exp] 234 / 1e-71 AT4G27220 227 / 3e-61 NB-ARC domain-containing disease resistance protein (.1) Potri.001G420000 [exp] 231 / 6e-71 AT4G27190 249 / 4e-68 NB-ARC domain-containing disease resistance protein (.1) Potri.001G446650 [exp] 229 / 5e-70 AT4G27190 247 / 2e-67 NB-ARC domain-containing disease resistance protein (.1) Potri.001G445700 [exp] 228 / 1e-69 AT4G27190 267 / 5e-74 NB-ARC domain-containing disease resistance protein (.1) Potri.001G446332 [exp] 228 / 2e-69 AT4G27220 241 / 1e-65 NB-ARC domain-containing disease resistance protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039540 [exp] 66 / 7e-13 AT3G14470 727 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Lus10019530 [exp] 61 / 5e-11 AT3G07040 311 / 4e-95 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) Lus10020016 [exp] 55 / 3e-09 AT3G07040 563 / 0.0 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) Lus10014922 [exp] 55 / 4e-09 AT3G07040 523 / 1e-171 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) Lus10002736 [exp] 55 / 5e-09 AT3G14470 317 / 1e-98 NB-ARC domain-containing disease resistance protein (.1) Lus10024173 [exp] 55 / 5e-09 AT3G14460 681 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10041243 [exp] 54 / 8e-09 AT3G07040 526 / 1e-172 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) Lus10039509 [exp] 54 / 9e-09 AT3G14460 613 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10006794 [exp] 54 / 1e-08 AT3G14470 264 / 2e-78 NB-ARC domain-containing disease resistance protein (.1) Lus10016316 [exp] 53 / 3e-08 AT3G14470 494 / 6e-156 NB-ARC domain-containing disease resistance protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00931 [poplar] [flax] NB-ARC NB-ARC domain
Representative CDS sequence Show only first row Show all	>Potri.001G444600.2 pacid=42793020 polypeptide=Potri.001G444600.2.p locus=Potri.001G444600 ID=Potri.001G444600.2.v4.1 annot-version=v4.1 ATGGCAGATAGTTTAGATCTGAAATTTGACAAGAAGAGTAAAGAAGGGAGAGCAAATGAACTATGGCAGAGACTGCAGGGAAAGAAGATGCTTATAGTCC TGGATGATGTTTGGAAAGATATTGACTTCCAAGAGATAGGGATCCCATTTGGTGATGATCACAGGTGTTGTAAAATTCTTCTAACAACACGTCTTGAAGA CAGGTGTTCTTATATGAAGTGCAAGGAAAAAGTGTTTTTAGGTCTCTTTTCTGAAGAGGAAGCATGGGCTTTATTCAGAATCAATGCAGATTTACGTGAC GAGGACTCTACCTTGAACACGGTGGCAAAGAAGGTTGCGAGAGAATGTAAAGGATTGCATACAGCACTTGTGACAGTGGGAAGGGCTCTAAGAGATAAAT CTGTTGTTGAGTGGGAAGTAGCGTCTGAAGAGCTCAAAAACTCTCAATTTCGGCATTTGGAACAAATTGACGGACAAAAAAAATGCATATGCATGTCTTA A
AA sequence Show only first row Show all	>Potri.001G444600.2 pacid=42793020 polypeptide=Potri.001G444600.2.p locus=Potri.001G444600 ID=Potri.001G444600.2.v4.1 annot-version=v4.1 MADSLDLKFDKKSKEGRANELWQRLQGKKMLIVLDDVWKDIDFQEIGIPFGDDHRCCKILLTTRLEDRCSYMKCKEKVFLGLFSEEEAWALFRINADLRD EDSTLNTVAKKVARECKGLHTALVTVGRALRDKSVVEWEVASEELKNSQFRHLEQIDGQKKCICMS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G61310			LRR and NB-ARC domains-contain...		Potri.001G444600 [exp]	0	1
AT4G27190			NB-ARC domain-containing disea...		Potri.001G419800 [exp]	1.73	0.9333
AT4G27190			NB-ARC domain-containing disea...		Potri.001G444000 [exp]	5.47	0.8985
AT4G10780			LRR and NB-ARC domains-contain...		Potri.017G035300 [exp]	12.04	0.9126
AT5G05830			RING/FYVE/PHD zinc finger supe...		Potri.006G094000 [exp]	12.96	0.8664
AT1G77210		AtSTP14	sugar transport protein 14, su...		Potri.009G048500 [exp]	18.97	0.8887
AT5G49690			UDP-Glycosyltransferase superf...		Potri.017G042800 [exp]	20.61	0.8325
AT4G27190			NB-ARC domain-containing disea...		Potri.001G429890 [exp]	21.33	0.8783
AT4G25550			Cleavage/polyadenylation speci...		Potri.012G140301 [exp]	22.91	0.8780
AT4G27190			NB-ARC domain-containing disea...		Potri.001G429430 [exp]	23.68	0.8840
AT4G27190			NB-ARC domain-containing disea...		Potri.005G042900 [exp]	25.45	0.8462	Pt-RGA-II24.67

Compare expression of checked genes

Potri.001G444600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.