PETE.2 (Potri.002G016000) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol PETE.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20340 185 / 1e-60 PETE2, DRT112 PLASTOCYANIN 2, DNA-DAMAGE-REPAIR/TOLERATION PROTEIN 112, Cupredoxin superfamily protein (.1)
AT1G76100 182 / 3e-59 PETE1 plastocyanin 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G246100 228 / 1e-77 AT1G20340 192 / 3e-63 PLASTOCYANIN 2, DNA-DAMAGE-REPAIR/TOLERATION PROTEIN 112, Cupredoxin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004155 190 / 1e-62 AT1G20340 221 / 8e-75 PLASTOCYANIN 2, DNA-DAMAGE-REPAIR/TOLERATION PROTEIN 112, Cupredoxin superfamily protein (.1)
Lus10034554 188 / 9e-62 AT1G20340 218 / 1e-73 PLASTOCYANIN 2, DNA-DAMAGE-REPAIR/TOLERATION PROTEIN 112, Cupredoxin superfamily protein (.1)
Lus10005628 172 / 6e-56 AT1G76100 190 / 4e-63 plastocyanin 1 (.1)
Lus10021839 166 / 7e-54 AT1G20340 170 / 2e-55 PLASTOCYANIN 2, DNA-DAMAGE-REPAIR/TOLERATION PROTEIN 112, Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF13473 Cupredoxin_1 Cupredoxin-like domain
Representative CDS sequence
>Potri.002G016000.1 pacid=42778557 polypeptide=Potri.002G016000.1.p locus=Potri.002G016000 ID=Potri.002G016000.1.v4.1 annot-version=v4.1
ATGGCCACTGTCACCTCTGCTGCTGTTTCTATCCCATCTTTCACCGGTCTTAAGGCAGCCAGTGCCTCCAATGCCAAAGTCAGTGCCAGTGCCAAGGTTT
CAGCCTCTCCACTTCCAAGGCTCAGCATCAAGGCTTCATTGAAAGAAGTCGGTGCTGCTGTTGTCGCCACCGCTGCTAGCGCAATGATTGCTAGCAATGC
TATGGCCGTTGACGTCTTGCTTGGAAGTGATGATGGATCATTGGCTTTTGTTCCCAGCGAATTCTCTGTACCCGCTGGTGAAAAGATTGTCTTCAAGAAC
AATGCCGGGTTCCCACATAACGTTCTCTTCGACGAGGACGCTGTTCCAAGTGGGGTTGATGTGTCAAAAATCTCCATGAGCGAGGAGGATCTCCTCAACG
CCAAAGGAGAGACTTTCGAAGTTGCCTTGAGCGACAAAGGTGAATACACTTTCTACTGTTCTCCTCACCAGGGAGCTGGCATGGTGGGAAAAGTGATCGT
TAATTAA
AA sequence
>Potri.002G016000.1 pacid=42778557 polypeptide=Potri.002G016000.1.p locus=Potri.002G016000 ID=Potri.002G016000.1.v4.1 annot-version=v4.1
MATVTSAAVSIPSFTGLKAASASNAKVSASAKVSASPLPRLSIKASLKEVGAAVVATAASAMIASNAMAVDVLLGSDDGSLAFVPSEFSVPAGEKIVFKN
NAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G20340 PETE2, DRT112 PLASTOCYANIN 2, DNA-DAMAGE-REP... Potri.002G016000 0 1 PETE.2
AT5G64040 PSAN, PSI-N photosystem I reaction center ... Potri.007G105900 1.00 0.9880
AT5G64040 PSAN, PSI-N photosystem I reaction center ... Potri.005G063300 2.00 0.9850
AT2G30570 PSBW photosystem II reaction center... Potri.005G218800 2.82 0.9868
AT2G06520 PSBX photosystem II subunit X (.1) Potri.006G222300 3.46 0.9824
AT4G10340 LHCB5 light harvesting complex of ph... Potri.019G063101 5.00 0.9847
AT4G23890 NdhS, CRR31 NADH dehydrogenase-like comple... Potri.003G140400 5.19 0.9786
AT1G08380 PSAO photosystem I subunit O (.1) Potri.004G199400 5.29 0.9822
AT4G02530 chloroplast thylakoid lumen pr... Potri.018G129600 6.32 0.9804
AT4G15510 Photosystem II reaction center... Potri.005G010700 7.21 0.9755
AT3G29230 Tetratricopeptide repeat (TPR)... Potri.006G265200 7.74 0.9715

Potri.002G016000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.