Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G07590 183 / 1e-61 Small nuclear ribonucleoprotein family protein (.1.2) AT4G02840 183 / 2e-61 Small nuclear ribonucleoprotein family protein (.1.2) AT1G20580 52 / 2e-09 Small nuclear ribonucleoprotein family protein (.1) AT1G76300 46 / 2e-07 SMD3 snRNP core protein SMD3 (.1) AT5G27720 43 / 5e-06 LSM4, EMB1644 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) AT1G03330 40 / 3e-05 Small nuclear ribonucleoprotein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G207900 [exp] 177 / 5e-59 AT4G02840 152 / 3e-49 Small nuclear ribonucleoprotein family protein (.1.2) Potri.002G010200 [exp] 53 / 7e-10 AT1G20580 214 / 5e-73 Small nuclear ribonucleoprotein family protein (.1) Potri.005G251100 [exp] 52 / 2e-09 AT1G20580 211 / 6e-72 Small nuclear ribonucleoprotein family protein (.1) Potri.002G205700 [exp] 43 / 6e-06 AT5G27720 179 / 5e-59 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Potri.014G130700 [exp] 41 / 3e-05 AT5G27720 176 / 7e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Potri.004G219000 [exp] 39 / 9e-05 AT1G03330 184 / 1e-62 Small nuclear ribonucleoprotein family protein (.1) Potri.003G014900 [exp] 39 / 9e-05 AT1G03330 184 / 1e-62 Small nuclear ribonucleoprotein family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028022 [exp] 174 / 1e-57 AT3G07590 181 / 1e-60 Small nuclear ribonucleoprotein family protein (.1.2) Lus10003727 [exp] 175 / 7e-57 AT3G07590 180 / 1e-58 Small nuclear ribonucleoprotein family protein (.1.2) Lus10025186 [exp] 159 / 5e-52 AT3G07590 169 / 6e-56 Small nuclear ribonucleoprotein family protein (.1.2) Lus10016068 [exp] 159 / 5e-52 AT3G07590 169 / 6e-56 Small nuclear ribonucleoprotein family protein (.1.2) Lus10030747 [exp] 52 / 3e-09 AT1G20580 214 / 2e-73 Small nuclear ribonucleoprotein family protein (.1) Lus10013227 [exp] 52 / 3e-09 AT1G20580 214 / 2e-73 Small nuclear ribonucleoprotein family protein (.1) Lus10016013 [exp] 52 / 3e-09 AT1G20580 219 / 3e-75 Small nuclear ribonucleoprotein family protein (.1) Lus10012263 [exp] 52 / 3e-09 AT1G20580 219 / 3e-75 Small nuclear ribonucleoprotein family protein (.1) Lus10004221 [exp] 43 / 2e-05 AT5G27720 182 / 2e-57 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10029426 [exp] 42 / 3e-05 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [poplar] [flax] Sm-like PF01423 [poplar] [flax] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Potri.002G054800.1 pacid=42776819 polypeptide=Potri.002G054800.1.p locus=Potri.002G054800 ID=Potri.002G054800.1.v4.1 annot-version=v4.1 ATGAAGCTCGTCAGGTTTTTGATGAAGCTGAACAATGAGACCGTCTCAATTGAACTCAAGAACGGAACTGTTGTTCATGGAACCATCACAGGTGTTGATA TCAGTATGAATACTCATCTGAAAACAGTGAAACTAACAGTGAAAGGGAAAAACCCAGTAACTTTGGATCATCTCAGCGTGAGGGGCAACAACATTCGTTA TTACATCCTTCCTGACAGCTTGAATCTTGAGACTTTGCTGGTTGAGGAGACACCTAGGGTCAAACCTAAGAAGCCAACAGCTGGGAGGGCTTTGGGTGGT CGAGGCAGGGGCCGTGGACGTGGTCGTGGGCGCGGACGTGGCCGCTAA
AA sequence Show only first row Show all	>Potri.002G054800.1 pacid=42776819 polypeptide=Potri.002G054800.1.p locus=Potri.002G054800 ID=Potri.002G054800.1.v4.1 annot-version=v4.1 MKLVRFLMKLNNETVSIELKNGTVVHGTITGVDISMNTHLKTVKLTVKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRALGG RGRGRGRGRGRGRGR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G07590			Small nuclear ribonucleoprotei...		Potri.002G054800 [exp]	0	1
AT2G47580		U1A	spliceosomal protein U1A (.1)		Potri.014G127800 [exp]	1.41	0.8291	Pt-U1A.2
AT1G17880		ATBTF3	basic transcription factor 3 (...		Potri.015G029800 [exp]	6.48	0.8299
AT1G16470		PAB1	proteasome subunit PAB1 (.1.2)		Potri.012G123550 [exp]	12.00	0.7232
AT2G29530		TIM10	Tim10/DDP family zinc finger p...		Potri.001G246500 [exp]	12.00	0.7954
AT4G33865			Ribosomal protein S14p/S29e fa...		Potri.009G090000 [exp]	12.16	0.8244
AT2G35605			SWIB/MDM2 domain superfamily p...		Potri.005G078400 [exp]	13.00	0.7841
AT1G56450		PBG1	20S proteasome beta subunit G1...		Potri.018G037700 [exp]	15.96	0.7808	Pt-PBG1.1
AT5G23290		PFD5, PDF5	prefoldin 5 (.1)		Potri.007G074042 [exp]	17.34	0.7992
AT3G13230			RNA-binding KH domain-containi...		Potri.011G166000 [exp]	17.74	0.7749
AT4G12600			Ribosomal protein L7Ae/L30e/S1...		Potri.013G116800 [exp]	17.74	0.8283

Compare expression of checked genes

Potri.002G054800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.