Potri.002G068800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G76860 174 / 1e-58 Small nuclear ribonucleoprotein family protein (.1)
AT1G21190 172 / 9e-58 Small nuclear ribonucleoprotein family protein (.1)
AT3G62840 55 / 5e-11 Small nuclear ribonucleoprotein family protein (.1.2)
AT2G47640 55 / 5e-11 Small nuclear ribonucleoprotein family protein (.1.2.3.4)
AT5G44500 50 / 2e-08 Small nuclear ribonucleoprotein family protein (.1.2)
AT4G20440 46 / 4e-07 SMB small nuclear ribonucleoprotein associated protein B (.1.2.3.4)
AT2G03870 42 / 5e-06 EMB2816 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2)
AT5G48870 40 / 2e-05 SAD1 SUPERSENSITIVE TO ABA AND DROUGHT 1, Small nuclear ribonucleoprotein family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G191600 190 / 1e-64 AT1G76860 176 / 3e-59 Small nuclear ribonucleoprotein family protein (.1)
Potri.002G204300 52 / 7e-10 AT3G62840 204 / 6e-70 Small nuclear ribonucleoprotein family protein (.1.2)
Potri.014G129100 52 / 7e-10 AT3G62840 204 / 6e-70 Small nuclear ribonucleoprotein family protein (.1.2)
Potri.001G440100 46 / 4e-07 AT4G20440 211 / 2e-67 small nuclear ribonucleoprotein associated protein B (.1.2.3.4)
Potri.011G155700 46 / 4e-07 AT4G20440 218 / 2e-70 small nuclear ribonucleoprotein associated protein B (.1.2.3.4)
Potri.001G269500 42 / 5e-06 AT2G03870 183 / 8e-62 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2)
Potri.009G064000 42 / 5e-06 AT2G03870 183 / 8e-62 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2)
Potri.001G277900 41 / 9e-06 AT5G48870 162 / 5e-54 SUPERSENSITIVE TO ABA AND DROUGHT 1, Small nuclear ribonucleoprotein family protein (.1)
Potri.009G072500 41 / 9e-06 AT5G48870 162 / 5e-54 SUPERSENSITIVE TO ABA AND DROUGHT 1, Small nuclear ribonucleoprotein family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040487 184 / 3e-62 AT1G76860 175 / 8e-59 Small nuclear ribonucleoprotein family protein (.1)
Lus10011293 184 / 3e-62 AT1G76860 175 / 8e-59 Small nuclear ribonucleoprotein family protein (.1)
Lus10026326 183 / 9e-62 AT1G76860 176 / 4e-59 Small nuclear ribonucleoprotein family protein (.1)
Lus10042341 136 / 6e-43 AT1G76860 132 / 2e-41 Small nuclear ribonucleoprotein family protein (.1)
Lus10030367 52 / 7e-10 AT2G47640 185 / 2e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4)
Lus10007876 52 / 7e-10 AT2G47640 185 / 2e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4)
Lus10013840 52 / 9e-10 AT2G47640 184 / 3e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4)
Lus10026556 52 / 9e-10 AT2G47640 184 / 3e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4)
Lus10023386 46 / 5e-07 AT5G44500 259 / 5e-87 Small nuclear ribonucleoprotein family protein (.1.2)
Lus10038421 46 / 5e-07 AT5G44500 263 / 2e-88 Small nuclear ribonucleoprotein family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0527 Sm-like PF01423 LSM LSM domain
Representative CDS sequence
>Potri.002G068800.1 pacid=42777514 polypeptide=Potri.002G068800.1.p locus=Potri.002G068800 ID=Potri.002G068800.1.v4.1 annot-version=v4.1
ATGGCAAGCGAAGAAGAGAGTGCGGTAAAAGAGCCATTGGATCTCATCAGACTTAGCCTGGACGAGCGTATCTACGTCAAGCTCCGCTCTGATCGTGAAC
TTCGCGGAAAACTCCACGCGTATGATCAGCATTTGAATATGATTCTTGGGGATGTTGAAGAAATTGTTACTACAGTCGAAATCGACGATGAAACCTATGA
AGAGATTGTTCGGGCTACAAGGCGCACAGTGCCTTTCCTATTCGTTAGAGGAGATGGTGTCATATTGGTCTCTCCTCCATTGAGGACAGCTTAA
AA sequence
>Potri.002G068800.1 pacid=42777514 polypeptide=Potri.002G068800.1.p locus=Potri.002G068800 ID=Potri.002G068800.1.v4.1 annot-version=v4.1
MASEEESAVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMILGDVEEIVTTVEIDDETYEEIVRATRRTVPFLFVRGDGVILVSPPLRTA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G76860 Small nuclear ribonucleoprotei... Potri.002G068800 0 1
AT4G22000 unknown protein Potri.015G012700 1.41 0.8938
AT4G28440 Nucleic acid-binding, OB-fold-... Potri.007G137600 2.00 0.8693
AT3G13550 EMB144, COP10, ... FUSCA 9, EMBRYO DEFECTIVE 144,... Potri.001G089300 2.44 0.8706
AT5G45590 Ribosomal protein L35 (.1) Potri.003G099900 5.47 0.8464
AT5G37055 ATSWC6, SEF SERRATED LEAVES AND EARLY FLOW... Potri.013G152600 5.74 0.8180
AT1G32730 unknown protein Potri.003G085901 6.48 0.8433
AT4G39280 phenylalanyl-tRNA synthetase, ... Potri.009G116100 6.70 0.8065
AT3G18940 clast3-related (.1) Potri.004G148500 7.93 0.7901
AT5G16790 AtTHO7 Tho complex subunit 7/Mft1p (.... Potri.013G082900 8.30 0.7799
AT5G55140 ribosomal protein L30 family p... Potri.002G225600 10.81 0.8316

Potri.002G068800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.